KEGG   Bos taurus (cow): 282022Help
Entry
282022            CDS       T01008                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
bta  Bos taurus (cow)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Platelet activation
Serotonergic synapse
Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    282022 (PTGS1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    282022 (PTGS1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    282022 (PTGS1)
  Nervous system
   04726 Serotonergic synapse
    282022 (PTGS1)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     282022 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BGD-bta: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
11
AA seq 600 aa AA seqDB search
MSRQGISLRFPLLLLLLSPSPVLPADPGAPAPVNPCCYYPCQHQGICVRFGLDRYQCDCT
RTGYYGPNCTIPEIWTWLRTTLRPSPSFVHFLLTHGRWLWDFVNATFIRDKLMRLVLTVR
SNLIPSPPTYNVAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRR
FLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLER
QYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMV
YATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLK
FDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVE
ALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRELRLQPFNEYRKRFGMKPYTSFQE
LTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPIC
SPEYWKASTFGGDVGFNLVKTATLKKLVCLNTKTCPYVSFHVPDPHREDRPGVERPPTEL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcagggtatctcgctccgattcccgctgcttctcctgctgctgtcgccgtcc
cccgtcttgccagcggaccccggggcgcccgcgccagtgaacccctgctgttactatcca
tgccagcaccaggggatctgtgttcgcttcggccttgaccgctaccaatgtgactgcacc
cgcacgggctattatggccccaactgcaccatccctgagatatggacctggctccggacg
actttgcggcccagcccgtctttcgtccactttctgctgacgcatgggcgctggctgtgg
gattttgtcaatgccaccttcatccgggacaagctcatgcgtctggtactcacagtgcgt
tccaaccttatccccagccctcccacctacaacgtagcgcatgactacatcagctgggag
tccttctccaatgtgagttattatactcgcattctgccctccgtgccccgagactgtccc
acgcccatgggcaccaaagggaagaagcagttgccagatgcggagtttctgagtcgtcgc
ttcctgctcaggaggaagttcatccccgaccctcaaggcaccaacctcatgtttgccttc
tttgcccaacacttcacccatcagttcttcaaaacttctggcaagatgggtcctggcttc
accaaggcgttgggccacggggtagacctcggccacatttatggagacaatctggaacgt
cagtatcagctgcggctctttaaggatgggaaactcaagtaccagatgctcaatggagag
gtgtacccgccatcggtggaagaggctcccgtgctgatgcactacccccggggcatcccg
ccccagagccagatggccgtgggccaggaggtgtttgggctgcttcctgggctcatggtc
tacgccacgatatggctgcgtgagcacaaccgcgtgtgtgacctgctgaaggctgagcac
ccgacctggggcgacgagcagctcttccagacggcccgcctcatcctcatcggggagacc
atcaagattgtgatagaggagtatgtgcagcagctgagcggctacttcctgcagctcaag
ttcgacccagagctgctgtttggggcccaattccagtaccgcaaccgcatcgccatggag
ttcaaccagctttaccactggcacccgctcatgcccgactccttccgggtgggcccccag
gactacagctacgagcagtttctgttcaacacctccatgctggtggactacggggtcgag
gccctggtggacgccttttctcgccagcctgcaggccggatcggtgggggtaggaacata
gaccaccacatcctgcacgtggccgtggatgtcatcaaggaatcgcgggagctgaggctg
cagcctttcaatgagtaccgcaagaggtttggcatgaagccctacacctctttccaggag
ctcacaggggagaaggagatggcagctgagttggaggagctgtatggagacatcgatgct
ttggaattctacccggggctacttcttgagaagtgccatccgaactccatctttggggag
agtatgatagaaatgggggctcctttttcccttaagggcctcttagggaaccccatctgt
tctccagagtactggaaggcaagcacatttggtggtgatgtgggcttcaaccttgtcaag
acggccacgctgaagaagctggtttgcctcaacaccaagacttgtccctacgtctccttc
catgtgccagacccccatcgggaggacaggcctggggtggagcggccacccacagagctc
tga

DBGET integrated database retrieval system