KEGG   Bos taurus (cow): 514767Help
Entry
514767            CDS       T01008                                 

Gene name
TGM5
Definition
(RefSeq) transglutaminase 5
  KO
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     514767 (TGM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BGD-bta: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
21
AA seq 595 aa AA seqDB search
MAEGLEVALTDLQSSWNNVQHHTDEISSSRLLVRRGQAFNITLYSRNRAFQPGLDNIIFV
TETGPLPDLSKGTRAVFSLEGHPGSSPWIASLQTIGANSLEVSLCAPPMAAVGRYLLKVH
IKSLQGPVTAYKLGEFILLFNPWCPEDAVYLESEPQRQEYVMNDYGFIYQGNKNWIRPCP
WNYGQFEENIIDICLELLDKSLNFQIDPATDCALRGSPVYISRVVSAMINSNDDNGVLNG
NWGENYSDGTNPTEWMGSVAILKQWHATGCQPVRYGQCWVFAAVTCTVMRCLGIPTRVIT
NFNSGHDTDGNLIIDEYYDNTGRILENKKKDSVWNFHVWNECWMARNDLPPGFGGWQVLD
ATPQETSNGLYCCGPASVRAIKEGEVDLNYDTAFAFSMVNADCMAWLVFGGKEQKLHQDT
STVGNFISTKSIQSDERDDITENYKYREAKTYPCKITYSQYSQYLSTDKLIRISALGEEK
NSPEKILVKKIITLAYPSIVINVLGAAIVNQPLSIQVVFSNPLSEQVEDCVLTVEGSGLF
RRQQRVLIGVLKPHHRASLTLETIPFKSGQRQIQANLRSNKFKDIKGYTNVYIGL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagggctggaggtggccctcaccgacctccagagctcctggaacaatgtgcag
caccacacagacgagatcagctccagtcgcctccttgttcgccggggccaggccttcaac
atcaccctgtactccaggaaccgggccttccagccaggcctggacaacatcatctttgtg
actgagactggaccactgccagatctgtccaaggggactcgagccgtgttcagcctggaa
ggtcaccctggctccagcccctggattgcctcactgcagaccattggggccaattccctg
gaggtgagcctgtgtgcccctcctatggcagctgtgggtcggtacctcttgaaggttcac
atcaaatccctacaggggcctgtcacagcctacaagctcggggagttcatcctgctcttc
aatccctggtgcccagaggatgctgtctacctggagagtgaaccccagaggcaggaatat
gtcatgaatgattatggcttcatctatcaagggaacaagaactggatccgcccctgcccc
tggaattatggacaatttgaagagaatatcatagacatctgtctggagctgctagacaag
agcctgaacttccagattgacccagccacagactgtgccctacggggcagcccggtctac
atcagcagagtggtgtccgccatgatcaacagcaacgatgacaatggggtgctcaatgga
aactggggcgagaattactcagatggcaccaaccccacagagtggatgggcagcgtggcc
atcctgaagcagtggcatgccacgggctgccagccagtgcgttacgggcagtgctgggtc
tttgctgctgtcacatgcacagtgatgaggtgtctggggatccccacccgagtgatcacc
aacttcaactctggccacgacacagacggaaacctgatcattgatgagtattatgacaac
acaggcaggattttggagaataagaagaaggacagtgtctggaatttccacgtctggaat
gaatgctggatggcacggaacgacctcccacctggattcggaggctggcaggtgctggac
gctacacctcaggagacaagcaatggcctctactgctgcggccctgcctccgtcagagcc
atcaaagaaggagaggtggatctgaactacgacacagccttcgccttttccatggtgaat
gctgactgtatggcctggctggtctttggagggaaggagcagaaacttcaccaggacacc
agtactgttggtaattttattagcaccaagagcatccagagtgatgagcgggatgacatc
acggaaaactacaagtatagagaagcaaagacctatccctgcaaaatcacctattcccag
tacagccagtacctgtccacagacaagctgatccgcatcagtgccctgggtgaagagaag
aacagtcctgaaaagatcctggtgaagaagatcatcaccttagcctatcccagcatcgtg
attaatgttttaggagcagccattgtgaaccagccgctctctatacaggtggtattttca
aaccccctctcggagcaggttgaagactgtgtgctgactgtggaaggaagcggtctcttc
aggagacagcagagagtcctcattggagtcctcaaaccccatcacagagccagtctcact
ctggagactatccccttcaagagtggccaaaggcaaatccaagcgaatctgaggagcaac
aaatttaaggacatcaagggttacacgaatgtctatattgggttataa

DBGET integrated database retrieval system