Budorcas taxicolor (takin): 128068546 Help Entry 128068546         CDS       T08909                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism btax  Budorcas taxicolor (takin) Pathway btax01523   Antifolate resistance btax04010   MAPK signaling pathway btax04014   Ras signaling pathway btax04024   cAMP signaling pathway btax04062   Chemokine signaling pathway btax04064   NF-kappa B signaling pathway btax04066   HIF-1 signaling pathway btax04071   Sphingolipid signaling pathway btax04137   Mitophagy - animal btax04151   PI3K-Akt signaling pathway btax04210   Apoptosis btax04211   Longevity regulating pathway btax04218   Cellular senescence btax04380   Osteoclast differentiation btax04613   Neutrophil extracellular trap formation btax04620   Toll-like receptor signaling pathway btax04621   NOD-like receptor signaling pathway btax04622   RIG-I-like receptor signaling pathway btax04623   Cytosolic DNA-sensing pathway btax04625   C-type lectin receptor signaling pathway btax04657   IL-17 signaling pathway btax04658   Th1 and Th2 cell differentiation btax04659   Th17 cell differentiation btax04660   T cell receptor signaling pathway btax04662   B cell receptor signaling pathway btax04668   TNF signaling pathway btax04722   Neurotrophin signaling pathway btax04917   Prolactin signaling pathway btax04920   Adipocytokine signaling pathway btax04926   Relaxin signaling pathway btax04931   Insulin resistance btax04932   Non-alcoholic fatty liver disease btax04933   AGE-RAGE signaling pathway in diabetic complications btax04936   Alcoholic liver disease btax05010   Alzheimer disease btax05022   Pathways of neurodegeneration - multiple diseases btax05030   Cocaine addiction btax05132   Salmonella infection btax05133   Pertussis btax05134   Legionellosis btax05135   Yersinia infection btax05140   Leishmaniasis btax05142   Chagas disease btax05145   Toxoplasmosis btax05146   Amoebiasis btax05152   Tuberculosis btax05160   Hepatitis C btax05161   Hepatitis B btax05162   Measles btax05163   Human cytomegalovirus infection btax05164   Influenza A btax05165   Human papillomavirus infection btax05166   Human T-cell leukemia virus 1 infection btax05167   Kaposi sarcoma-associated herpesvirus infection btax05168   Herpes simplex virus 1 infection btax05169   Epstein-Barr virus infection btax05170   Human immunodeficiency virus 1 infection btax05171   Coronavirus disease - COVID-19 btax05200   Pathways in cancer btax05202   Transcriptional misregulation in cancer btax05203   Viral carcinogenesis btax05207   Chemical carcinogenesis - receptor activation btax05208   Chemical carcinogenesis - reactive oxygen species btax05212   Pancreatic cancer btax05215   Prostate cancer btax05220   Chronic myeloid leukemia btax05221   Acute myeloid leukemia btax05222   Small cell lung cancer btax05235   PD-L1 expression and PD-1 checkpoint pathway in cancer btax05321   Inflammatory bowel disease btax05415   Diabetic cardiomyopathy btax05417   Lipid and atherosclerosis btax05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:btax00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128068546 (RELA)    04014 Ras signaling pathway     128068546 (RELA)    04064 NF-kappa B signaling pathway     128068546 (RELA)    04668 TNF signaling pathway     128068546 (RELA)    04066 HIF-1 signaling pathway     128068546 (RELA)    04071 Sphingolipid signaling pathway     128068546 (RELA)    04024 cAMP signaling pathway     128068546 (RELA)    04151 PI3K-Akt signaling pathway     128068546 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     128068546 (RELA)   09143 Cell growth and death    04210 Apoptosis     128068546 (RELA)    04218 Cellular senescence     128068546 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     128068546 (RELA)    04620 Toll-like receptor signaling pathway     128068546 (RELA)    04621 NOD-like receptor signaling pathway     128068546 (RELA)    04622 RIG-I-like receptor signaling pathway     128068546 (RELA)    04623 Cytosolic DNA-sensing pathway     128068546 (RELA)    04625 C-type lectin receptor signaling pathway     128068546 (RELA)    04660 T cell receptor signaling pathway     128068546 (RELA)    04658 Th1 and Th2 cell differentiation     128068546 (RELA)    04659 Th17 cell differentiation     128068546 (RELA)    04657 IL-17 signaling pathway     128068546 (RELA)    04662 B cell receptor signaling pathway     128068546 (RELA)    04062 Chemokine signaling pathway     128068546 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     128068546 (RELA)    04917 Prolactin signaling pathway     128068546 (RELA)    04926 Relaxin signaling pathway     128068546 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     128068546 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     128068546 (RELA)   09149 Aging    04211 Longevity regulating pathway     128068546 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     128068546 (RELA)    05202 Transcriptional misregulation in cancer     128068546 (RELA)    05207 Chemical carcinogenesis - receptor activation     128068546 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     128068546 (RELA)    05203 Viral carcinogenesis     128068546 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     128068546 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     128068546 (RELA)    05221 Acute myeloid leukemia     128068546 (RELA)    05220 Chronic myeloid leukemia     128068546 (RELA)    05215 Prostate cancer     128068546 (RELA)    05222 Small cell lung cancer     128068546 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     128068546 (RELA)    05170 Human immunodeficiency virus 1 infection     128068546 (RELA)    05161 Hepatitis B     128068546 (RELA)    05160 Hepatitis C     128068546 (RELA)    05171 Coronavirus disease - COVID-19     128068546 (RELA)    05164 Influenza A     128068546 (RELA)    05162 Measles     128068546 (RELA)    05168 Herpes simplex virus 1 infection     128068546 (RELA)    05163 Human cytomegalovirus infection     128068546 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     128068546 (RELA)    05169 Epstein-Barr virus infection     128068546 (RELA)    05165 Human papillomavirus infection     128068546 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     128068546 (RELA)    05135 Yersinia infection     128068546 (RELA)    05133 Pertussis     128068546 (RELA)    05134 Legionellosis     128068546 (RELA)    05152 Tuberculosis     128068546 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     128068546 (RELA)    05145 Toxoplasmosis     128068546 (RELA)    05140 Leishmaniasis     128068546 (RELA)    05142 Chagas disease     128068546 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     128068546 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     128068546 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     128068546 (RELA)   09165 Substance dependence    05030 Cocaine addiction     128068546 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     128068546 (RELA)    05418 Fluid shear stress and atherosclerosis     128068546 (RELA)    05415 Diabetic cardiomyopathy     128068546 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     128068546 (RELA)    04932 Non-alcoholic fatty liver disease     128068546 (RELA)    04931 Insulin resistance     128068546 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     128068546 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     128068546 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:btax03000]     128068546 (RELA) Transcription factors [BR:btax03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     128068546 (RELA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  128068546 NCBI-ProteinID:  XP_052517633 LinkDB All DBs Position 25:complement(44575353..44584301) Genome browser AA seq 555 aa AA seqDB search MDDFFPIIFSEEPVQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLAPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPPTRRIAVPNRGSASIPKPAPQPYSFTPSLSTINF EEFSPMVFPSGQIPSQTSALAPAPTPVLTQTPVLAPVPAPAPAPAPGMASTLAQALAPGL AQAVTPPAPKTNQTGEGTLTEALLQLQFDTDEDLGALLGNNTDPAVFTDLASVDNSEFQQ LLNQGVPMGPHTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGPPGLTNGLLSGDEDFSS IADVDFSALLSQISS NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt atggacgacttcttccccatcatcttctccgaagagcctgtgcaggcctctggcccctat gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggc cgctcagccggcagcatccctggcgagaggagcacagacaccaccaagacccaccccact atcaagatcaatggctacacggggccagggacagtccgcatctcgctggtcaccaaggac cctcctcaccggcctcaccctcacgagctagtggggaaagactgccgggatggcttctat gaggctgagctctgcccggaccgctgcatccacagctttcagaacctggggatccagtgt gtaaagaagcgggacttggagcaggccatcagccaacgcatccagaccaacaacaacccc ttccaagttcccatagaagagcagcgcggggactacgacctgaatgccgtgcggctctgc ttccaggtgacagtgcgggacccggcaggcaggcccctccgcctggcgcctgtcctctct catcccatctttgacaaccgcgcccccaacaccgccgagctcaagatctgccgggtaaat cggaactctgggagctgcctcggcggggacgagatcttcctgctgtgtgacaaggtgcag aaagaggacatcgaggtgtatttcacgggaccaggctgggaggcccgaggctctttttca caagctgacgtgcaccggcaagtggccatcgtgttccggacgccgccctatgcggacccc agcctgcaggcccctgtgcgtgtctccatgcagctgcggcggccttctgatcgggagctc agcgagcccatggaattccagtacttgccagacacagatgatcgtcaccggattgaggag aagcgcaaaaggacatacgagaccttcaagagcatcatgaaaaagagccctttcaatgga cccaccgacccccggcctccaacccggcgcatcgctgtgcctaaccgcggctcagcctcc atccccaagccagctccccagccctattcctttacgccatctctcagcaccatcaacttt gaggagttttcccccatggtctttccttctgggcagatcccaagccagacctcggccttg gcaccagcccccaccccggtcctgacccagaccccagtcctggccccggtcccagcccca gccccagctccagccccaggcatggcatcaaccctggcccaggccctagccccaggcctg gctcaggctgtgaccccgcctgcccccaagaccaaccagactggggaagggacactgaca gaggccctgctgcagctgcagtttgataccgatgaagacctgggggctctgcttggcaac aacactgaccctgccgtgttcacagacctggcatctgtcgacaactctgagtttcagcag ttgctgaaccagggtgtacccatgggcccccacacagctgagcccatgctgatggagtac cctgaggctataactcgcctggtgacagggtcccagaggccccctgacccagctcccact cccctggggccccctgggctcaccaacggcctcctctcgggggatgaagacttctcctcc atcgcggacgtggacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system