KEGG   Bacillus thuringiensis BMB171: BMB171_C1850Help
Entry
BMB171_C1850      CDS       T01239                                 

Gene name
dal2
Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BMB171_C1850 (dal2)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BMB171_C1850 (dal2)
Enzymes [BR:btb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BMB171_C1850 (dal2)
Peptidoglycan biosynthesis and degradation proteins [BR:btb01011]
 Precursor biosynthesis
  Racemase
   BMB171_C1850 (dal2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1965977..1967152
Genome map
AA seq 391 aa AA seqDB search
MSLKYGRDTIVEIDLNAVKHNVKEFKKHVNDEEIKMMAAVKANGYGHGAVEVAKAAIEAG
IHQLAVAFVDEAIELREAGITVPILILGYTPVAAVEDVIQYDVMMTVYRVEDLHGINEIA
NRLQKKVQIQVKIDTGMSRIGLQEEEVKPFLEELNRMEYVEVVGIFTHYSTADEIDKSYT
NMQTSLFEKAVNTAKELGIQIPYIHSSNSAGSMELSNTFQNMVRVGIGVYGMYPSKEVDH
SVVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIATVPIGYADGYNRQLSNKG
YALINGVRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQGEENIAVEEIADMLGTIN
YEVTCMLDRRIPRVYKENDETTAVVNILRKN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaaatatggaagagatacaattgtagaaattgacttaaatgctgtaaaacat
aatgtaaaagaatttaaaaaacatgtaaatgatgaagaaattaagatgatggctgctgta
aaagcgaatgggtatggccatggggcagttgaagttgccaaagctgcaattgaagctggg
atacatcaacttgcagttgcatttgtagatgaagcaatagaattaagagaagcaggaatt
actgtgccgattttaattttaggatacacaccagtagcggctgtagaagatgtaattcaa
tatgacgttatgatgactgtttatagagtagaagatttacatggtataaatgaaattgca
aaccgtcttcaaaagaaagtacaaattcaagtgaaaattgatacaggaatgagtcgtatc
ggtttacaagaagaagaagttaaaccatttttagaagaattaaaccgtatggagtatgta
gaggtagtagggatatttacgcattactctacggcagatgaaatcgataaatcatatacg
aatatgcaaacaagtttatttgaaaaggctgttaatacagcgaaagaattaggaattcaa
ataccatatattcatagttcaaatagtgcgggatcaatggaattaagtaacacatttcaa
aatatggtacgcgttggaataggagtgtacggtatgtatccgtcaaaagaagtggatcat
tcagtcgtttctttacagcctgcgttgtcgttaaaatcaaaagtagctcatattaaacat
gcgaagaagaatcgtggtgtaagttatgggaatacgtatgtaacaactggtgaagaatgg
attgcgactgtaccaattggttatgctgatggttataatcgtcaattatctaataaaggc
tatgcgttaattaacggggttcgagtacctgttattggccgtgtttgtatggaccagtta
atgttggatgtttcaaaagcgatgccagtacaagtaggagacgaagtagtattctacggt
aaacaaggtgaagaaaatatcgcagtagaagaaatagcggatatgttaggtacaataaat
tatgaagttacatgtatgctagatagaagaattccgcgtgtctataaagaaaatgacgaa
acaactgcagttgtaaatatattaagaaaaaactga

DBGET integrated database retrieval system