KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH3969Help
Entry
CT43_CH3969       CDS       T01838                                 

Gene name
tgl
Definition
(GenBank) transglutaminase
  KO
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Brite
Enzymes [BR:btc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     CT43_CH3969 (tgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3986214..3987044
Genome map
AA seq 276 aa AA seqDB search
MIVIGRSIVHPYITNEYEPFAAEKQQILSIMAGNQEVYSFRTADELSFDLNLRVNIIISA
LELFQSGFQFRTFQQSFCNPQYWKRTSLGGFELLPNIPPSIAIQDIFKNGKLYGTECATA
MIIIFYKALLSLYEEETFNRLFANLLLYTWDYDQDLRLITKTGGDLVPGDLVYFKNPQVN
PATIEWQGENTIYLGNFFFYGHGVGVKTKEEIIYSLNERRVPYAFISAFLTDTITRIDSR
IMSQYASSSTPQTSISFIPIRDDAIVATVGHTTTIY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaataggccgttctattgtacatccttatattacaaatgaatatgagccattt
gcagcagagaaacaacaaattttatcaataatggcaggaaatcaagaagtttattccttc
cgaacagctgatgaactcagctttgatctcaatttacgagttaatattattatctctgca
ctagaactttttcaaagtggatttcagtttcgcacatttcaacaatccttttgcaacccc
cagtattggaaaagaacatcccttggaggattcgagcttcttccaaacataccaccttct
attgccatacaagatattttcaaaaacggaaaactatatggaactgaatgcgcaaccgct
atgatcattattttttataaagctttattatcattgtatgaggaagaaactttcaatcgt
ctatttgcaaaccttttactttatacatgggactacgatcaagatctaaggctcataaca
aaaaccggtggcgatcttgttccaggtgacctcgtttactttaaaaacccacaagtgaat
ccagctacgattgagtggcaaggagaaaacacaatctatttaggaaatttctttttttac
ggacatggcgtaggtgtaaaaacaaaagaagaaattatttattcattaaatgaacgacga
gtcccttacgcttttatttcagctttcttgaccgatactattacccgtatagatagccgt
ataatgagccaatacgcttcttctagtacaccacagacatccataagctttattccaatt
agagatgatgcaatcgttgcaacagttggccatacaactacaatttattaa

DBGET integrated database retrieval system