KEGG   Burkholderia thailandensis MSMB121: BTI_2819Help
Entry
BTI_2819          CDS       T02644                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:btd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTI_2819
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BTI_2819
   00680 Methane metabolism
    BTI_2819
Enzymes [BR:btd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BTI_2819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:3104978..3107962
Genome map
AA seq 994 aa AA seqDB search
MKSSGSARATRRNAVSSSSAPANAELPARRAAKPARKRNGAAVRTIAPTNAASAKPQGRT
REDKDRPLFEDIRYLGRLLGDVVREQEGDAVFDIVETIRQTAVKFRREDDKAAAQTLEKM
LRKLTPDQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQAGTVAYALDRLRQA
GDASPKTIKQFFEGALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQPLTARELAHNE
ALLRARVTTLWQTRMLRDARLTVADEIENALSYYRATFLDELPALYADIEEALAEHGLPA
RVPAFFQMGSWIGGDRDGNPNVTATTLDEAITRQAAVIFEHYLEQVHKLGAELSASNLLV
GASDALKALAAASPDQSPHRVDEPYRRALIGVYTRLAASARVRLGEGAVPVRSAGRGAAP
VRATPYADAEEFVADLRVLTDSLALHHGESLATPRLAPLTRAAEVFGFHLASIDLRQSSD
IHEAVIAELLARGGVEPDYAALPEADKLRVLLAALADPRPLRSPYLDYSDLAKSELGVLE
RARAIRAQFGARAVRNYIISHTETVSDLVEVLLLQKETGLFEGTLGTPHANARNSLMAIP
LFETIADLRNASDIMREFFALPGVSELLAHQGHEQEVMLGYSDSNKDGGFLTSNWELYRG
ELALVDLFHERGIKLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEVIASK
FSNPEIGRRNLETVVAATLEATLAPHSNAPKQLPAFEATMQALSDAAMASYRALVYETPG
FTDYFFSSTPITEIAELNIGSRPASRKLQDPKNRRIEDLRAIPWGFSWGQCRLLLTGWYG
FGSAVAAYLDGAPDAAERGKRVALLKKMNKTWPFFANLLSNMDMVLAKTDLAVASRYAQL
VADKKLRKHVFERIVAEWHRTADALAEITGTEARLAANPLLARSIKNRFPYLDPLNHLQV
ELIKRHRAGDSNARLRRGIHLTINGIAAGLRNTG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgcgcgacgcgccgcaatgctgtctcgtcctcctccgcc
ccggcgaacgccgagcttcccgcccgccgcgccgcgaaacccgcgcgcaagcgcaacggc
gccgccgtgcgcacgatcgcgccgacgaacgccgcatccgcgaaaccccagggccgcacg
cgcgaggacaaggaccgcccgctcttcgaggacatccgctatctcggccgcctgctcggc
gacgtcgttcgcgagcaggaaggcgacgccgtgttcgacatcgtcgagacgatccgccag
accgccgtcaagttccgccgcgaggacgacaaggccgccgcgcagacgctcgaaaaaatg
ctgcgcaagctgacgcccgaccagacggtgagcgtcgtgcgcgcgttcagctatttctcg
cacctcgcgaacatcgccgaggaccgccatcacaaccgccgccgccggatccacgcgctc
gcgggctccgcgccgcaggcgggcaccgtcgcgtacgcgctcgacaggctccggcaggcg
ggcgacgcgtcgccgaagacgatcaagcagttcttcgaaggcgcgctgatcgtgcccgtg
ctgaccgcgcacccgaccgaagtgcagcgcaagagcattctcgacgcgcagcacgacatc
gcgcgcctgctcgccgagcgcgaccagccgctgaccgctcgcgagctcgcgcacaacgag
gcgctgctgcgcgcgcgcgtgacgacgctctggcagacccggatgctgcgcgacgcgcgc
ctgacggtcgccgacgagatcgagaacgcgctgtcgtactaccgcgcgacgttcctcgac
gagctgcccgcgctctacgcggacatcgaggaggcgctcgccgagcacggcctgcccgcg
cgcgtgccggcgttcttccagatgggtagctggatcggcggcgaccgcgacggcaacccg
aacgtcaccgccacgacgctcgacgaggcgatcacccgccaggcggcggtaatcttcgag
cattacctggagcaggtgcacaagctgggcgcggagctctccgcgtcgaacctgctcgtc
ggcgcgagcgatgcgctgaaggcgctcgcggccgcgtcgccggaccagtcgccgcaccgc
gtcgacgagccgtaccgccgcgcgctgatcggcgtctacacgcggctcgcggcaagcgcg
cgcgtgcggctgggcgaaggcgcagtgcccgtgcggagcgcgggccgcggcgccgcgccc
gtgcgcgcgacgccgtatgcggacgcggaggaattcgtcgccgatctgcgcgtgctgacc
gattcgctcgcgctgcatcacggcgaatcgcttgcgacgccgcgcctcgcgccgctcacg
cgcgcggccgaggtgttcggcttccatctcgcgagcatcgacttgcggcagagctcggac
atccatgaagccgtgatcgccgagctgctcgcgcgcggcggcgtcgagcccgactacgcg
gcgctgcccgaagcggacaagctgcgcgtgctgctcgcggcgctcgcggacccgcggccg
ctgcgctcgccgtatctcgactattcggacctcgcgaagagcgagctcggcgtgctcgag
cgcgcgcgcgcgatccgcgcgcagttcggcgcgcgcgcggtgcgcaactacatcatctcg
cacaccgagacggtgagcgacctcgtcgaagtgctgctgctgcagaaggaaacgggcctc
ttcgaaggcacgctcggcacgccgcacgccaacgcgcgcaacagcctgatggcgattccg
ctcttcgagacgatcgccgatctgcgcaacgcgtccgacatcatgcgcgaattcttcgcg
ctgccgggcgtgagcgagctgctcgcgcaccaaggccacgagcaggaagtgatgctcggc
tattcggacagcaacaaggacggcggcttcctcacgtcgaactgggagctctatcgcggg
gaactggcgctcgtcgacctgttccacgagcgcgggatcaagctgcgcctgttccacggc
cgcggcggcacggtgggccgcggcggcggtcccacctatcaggcgatcctgtcgcagccg
cccggcacggtgaacggccagatccggctgaccgagcagggcgaggtgatcgcgagcaag
ttctcgaacccggagatcggccggcgcaatctggagacggtcgtcgccgcgacgctcgag
gcgacgctcgcgccgcacagcaacgcgccgaagcaattacctgcgttcgaagcgacgatg
caggcgctgtcggatgcggcgatggcgtcgtaccgcgcgctcgtctacgagacgcccggc
ttcaccgactacttcttctcgtcgacgccgatcaccgagatcgccgagctgaacatcggc
agccggcccgcttcgcgcaagctgcaggacccgaagaatcgcaggatcgaggatctgcgc
gcgattccgtggggcttctcgtggggccagtgccggctgctgctgactggctggtacggc
ttcggcagcgcggtcgccgcgtatctcgacggcgcgccggacgcggccgagcgcggcaag
cgcgtcgcgctgctcaagaagatgaacaagacctggccgttcttcgcgaacctgctgtcg
aacatggacatggtgctcgcgaagaccgatctcgcggtcgcatcgcgctatgcgcagctc
gtcgccgacaagaagctgcgcaagcacgtgttcgagcggatcgtcgccgaatggcaccgc
acggcggacgcgctcgccgagatcaccggcaccgaggcgcggctcgccgcgaatccgctc
ctcgcgcgctcgatcaagaaccgcttcccgtacctcgatccgctgaaccacctgcaagtc
gagctgatcaagcggcaccgcgcgggagactcgaacgcgcggctgcggcgcgggatccac
ctgacgatcaacgggatcgcggccggcctgcgcaatacgggttga

DBGET integrated database retrieval system