KEGG   Burkholderia thailandensis E264: BTH_I0871Help
Entry
BTH_I0871         CDS       T00311                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bte  Burkholderia thailandensis E264
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTH_I0871 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BTH_I0871 (ppc)
   00680 Methane metabolism
    BTH_I0871 (ppc)
Enzymes [BR:bte01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BTH_I0871 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:complement(991841..995107)
Genome map
AA seq 1088 aa AA seqDB search
MVARASRATARLAGCASGPHGLRQDPERSFGSRRHPASASGSGPPPPHRSPRRPVSSTDA
PARAVQRAPPHRLIALAVAGPQFPFTRAFPRKSIVKSSGSARATRRNAVSSSSAPANAEL
PARRAAKTARKPNGAAARTIAPTNAASAKPHGRTREDKDRPLFEDIRYLGRLLGDVVREQ
EGDAVFDVVETIRQTAVKFRREDDKTAAQTLEKMLRKLTPEQTVSVVRAFSYFSHLANIA
EDRHHNRRRRIHALAGSAPQAGTVAYALDKLRQAGDASSKTIKQFFEGALIVPVLTAHPT
EVQRKSILDAQHDIARLLAERDQPLTARERAHNEALLRARVTTLWQTRMLRDARLTVADE
IENALSYYRATFLDELPALYTDIEEALAEHGLPARVPAFFQMGSWIGGDRDGNPNVTAAT
LDEAINRQAAVIFEHYLEQVHKLGAELSVSNLLVGASDALKALAAASPDQSPHRVDEPYR
RALIGVYTRLAASARVRLGEGAVPVRSAGRGAAPVRATPYADAEEFVADLRVLTDSLAVH
HGESLATPRLAPLMRAAEVYGFHLASIDLRQSSDIHEAVIAELLARGGVEPDYAALPEAD
KLRVLLAALADPRPLRSPYLDYSDLAKSELGVLERAHAIRAQFGARAVRNYIISHTETVS
DLVEVLLLQKETGLFEGTLGAPHANARNGLMVIPLFETIADLRNASDIMREFFALPGVGE
LLAHQGHEQEVMLGYSDSNKDGGFLTSNWELYRAELALVDLFHERGIKLRLFHGRGGTVG
RGGGPTYQAILSQPPGTVNGQIRLTEQGEVIASKFANPEIGRRNLETVVAATLEATLAPH
SNAPKQLPAFEAAMQTLSDAAMASYRALVYETPGFTDYFFSSTPITEIAELNIGSRPASR
KLQDPKHRKIEDLRAIPWGFSWGQCRLLLTGWYGFGGAVAAYLDGAPDAAERGKRVALLR
KMNKTWPFFANLLSNMDMVLAKTDLAVASRYAQLVADKKLRKHVFERIVAEWHRTASALA
EITGAQARLAANPLLARSIKNRFPYLDPLNHLQVELIKRHRAGDTNARLRRGIHLTINGI
AAGLRNTG
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atggtagcacgcgcatctcgcgcgaccgcccgcctggcgggctgcgcgagcggcccgcac
ggtctgcgtcaagatcccgaacggtcgttcggttcgagaaggcatccggcatccgcgagc
gggtccggtccgccgccgccgcatcgctcgccgcgtcgcccggtttcgtcgaccgacgca
cccgcgcgcgccgtgcagcgcgcgccgccgcatcgcttgatcgcgctcgctgttgctgga
ccgcagttcccgttcactcgtgctttcccaaggaaatcgatcgtgaagtcttccggatcg
gcgcgcgcgacgcgccgcaatgctgtctcgtcctcctccgccccggcgaacgccgagctc
cccgcccgccgcgccgcgaaaaccgcgcgcaagcccaacggcgccgccgcgcgcacgatc
gcgccgacgaatgccgcatccgcgaaaccgcacggccgcacgcgcgaagacaaggatcgc
ccgctgttcgaggacatccgctatctgggccgcctgctcggcgacgtcgttcgcgagcag
gaaggcgacgccgtgttcgacgtcgtcgagacgatccgccagaccgccgtcaagttccgc
cgcgaggacgacaagaccgccgcgcagacgctcgagaagatgctgcgcaagctcacgccc
gagcagacggtgagcgtcgtgcgcgcgttcagctatttctcgcacctcgcgaacatcgcc
gaggaccgccaccacaaccgccgccgcagaatccacgcgctcgcgggctccgcgccgcag
gcgggcaccgtcgcgtacgcgctcgacaagctcaggcaggcgggcgacgcgtcgtcgaag
acgatcaagcagttcttcgagggcgcgctgatcgtgcccgtgctgaccgcgcacccgacc
gaagtgcagcgcaagagcattctcgacgcgcagcacgacatcgcgcggctgctcgccgag
cgcgaccagccgctcaccgcgcgcgagcgcgcgcacaacgaggcgctgctgcgcgcgcgc
gtgacgacgctctggcagacccggatgctgcgcgacgcgcggctcaccgtcgccgacgag
atcgagaatgcgctgtcgtactaccgcgcgacgttcctcgacgagctgcccgcgctctac
acggacatcgaggaggcgctcgccgagcacggcctgcccgcgcgcgtgccggcgttcttc
cagatgggcagctggatcggcggcgaccgcgacggcaacccgaacgtcaccgccgcgacg
ctcgacgaggcgatcaatcgccaggcggcggtgatcttcgagcattacctggaacaggtg
cacaagctgggcgcggagctctccgtgtcgaacctgctcgtcggcgcgagcgacgcgctg
aaggcgctcgcggccgcgtcgccggaccagtcgccgcaccgcgtcgacgagccgtaccgc
cgcgcgctgatcggcgtctacacgcggcttgcggcaagcgcgcgcgtgcggctcggcgaa
ggcgcggtgcccgtgaggagcgcgggccgcggcgccgcgcccgtgcgcgccacgccgtat
gcggacgccgaggaattcgtggccgacctgcgcgtgctgaccgattcgctcgccgtgcat
cacggcgaatcgctcgcgacgccgcgcctcgcgccgctcatgcgcgcggccgaggtgtac
ggctttcatctcgcgagcatcgacttgcggcaaagctcggacatccatgaagcggtgatc
gccgagctgctcgcgcgcggcggcgtcgagcccgactacgcggcgctgcccgaagcggac
aagctgcgcgtgctgctcgcggcgctcgcggacccgcggccgctgcgctcgccgtatctc
gactactcggacctcgcgaagagcgagctcggcgtgctcgagcgcgcgcacgcgatccgc
gcgcagttcggcgcgcgcgcggtgcgcaactacatcatttcgcataccgagacggtgagc
gacctcgtcgaagtgctgctgctgcagaaggaaacgggcctcttcgagggcacgctcggc
gcgccgcacgcgaacgcgcgcaacggcctgatggtgattccgctcttcgagacgatcgcc
gacctgcgcaacgcgtccgacatcatgcgcgaattcttcgcgctgccgggcgtgggcgag
ctgctcgcgcaccagggccacgagcaggaagtgatgctcggctattcggacagcaacaag
gacggcggcttcctcacgtcgaactgggagctctaccgcgcggaactggcgctcgtcgat
ctgttccacgagcgcgggatcaagctgcgcctgttccacggccgcggcggcacggtgggc
cgcggcggcggcccgacctatcaggcgattctgtcgcagccgcccggcacggtgaacggc
cagatccggctcaccgagcagggcgaggtgatcgcgagcaagttcgcgaaccccgagatc
ggccggcgcaatctggagacggtcgtcgccgcgacgctcgaggcgacgctcgcgccgcac
agcaacgcgccgaagcagttgccggcgttcgaggcggcgatgcagacgctgtccgatgcg
gcgatggcgtcgtaccgcgcgctcgtctacgagacgcccggctttaccgactacttcttc
tcgtcgacgccgatcaccgagatcgccgagctgaacatcggcagccgccccgcgtcgcgc
aagctgcaggacccgaagcaccgcaagatcgaggatctgcgcgcgattccgtggggtttc
tcgtggggccagtgccggctgctgctgacgggctggtacggcttcggcggcgcggtagcc
gcgtatctcgacggcgcgccggacgcggccgagcgcggcaagcgcgtcgcgctgctcagg
aagatgaacaagacctggccgttcttcgcgaacctgctgtcgaacatggacatggtgctc
gcgaagaccgatctcgcagtcgcgtcgcgctacgcgcagctcgtcgccgacaagaagctg
cgcaagcacgtgttcgagcggatcgtcgccgaatggcaccgcacggcgagcgcgctcgcc
gagatcaccggcgcgcaagctcggctcgccgcgaatccgctcctcgcgcgctcgatcaag
aaccgcttcccgtacctcgatccgctgaaccacctgcaggtcgagctgatcaagcggcac
cgcgcgggcgacacgaacgcgcggctgcggcgcgggatccacctgacgatcaacgggatc
gcggccggcctgcgcaatacgggctga

DBGET integrated database retrieval system