KEGG   Bombus terrestris (buff-tailed bumblebee): 100644228Help
Entry
100644228         CDS       T04364                                 

Definition
(RefSeq) hexokinase type 2 isoform X3
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bter00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100644228
   00051 Fructose and mannose metabolism
    100644228
   00052 Galactose metabolism
    100644228
   00500 Starch and sucrose metabolism
    100644228
   00520 Amino sugar and nucleotide sugar metabolism
    100644228
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100644228
Enzymes [BR:bter01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100644228
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
AA seq 455 aa AA seqDB search
MKTSTLSSSDMIKQEIRDICKELILSNEQLHMVMQKLDDEMNKGLSKETHDQAVVKCFAT
YVQDLPDGSEKGHFLALDLGGTNFRVLLITLDHQNFDMKSKIYAIPQSLMLGTGTQLFDH
IAQCLALFVKDLNLHNERLPLGFTFSFPLSQQGLTKGYLVRWTKGFNCSGVVGEDVVALL
EKAIEKRKDVKIEVCAILNDTTGTLMSCAWKNRNCRIGLIVGTGTNACYVEKTSNVQCAI
PGNFSQEKPHMLINIEWGAFGEGGVLDFILTEFDRAIDENSINPSKQLFEKMISGMYMGE
LTRLVLEKVVNAGLLFGGKCPSDLKKRGKFFTKYVSEIENDAKGKYTNCREVLAELGLRN
VSDQDCENVRYVCSVVSRRAAHLASAGIATLLNKMGEDSVTVGIDGSVYRFHPYFHELMT
EKISQLQNYKFDLMLSEDGSGRGAALVAAVAAGHR
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgtcgacgttatcctccagtgacatgatcaaacaggagataagagatatctgc
aaggagctgatcctttccaacgaacagctccatatggttatgcaaaagttggacgatgag
atgaacaaaggtctatcgaaggaaacgcacgatcaggcggttgtgaaatgtttcgcgacc
tacgtccaagaccttcccgatggcagtgagaagggccactttctggccttggatctggga
gggacgaatttcagggtgctcttgatcaccttggatcaccagaatttcgacatgaagagc
aaaatctacgccataccacagagtctcatgttagggactggcacacagcttttcgatcat
atagctcagtgtttggcattgttcgtcaaggatctgaaccttcacaacgagcgtctacct
ctcggttttacgttcagcttcccattgtctcaacaaggactgaccaaaggctacctagtc
aggtggacgaagggttttaactgcagcggtgtagtcggcgaagacgtggttgctttgctc
gaaaaggcaatcgaaaaaagaaaagacgtgaaaatcgaggtatgcgccattctgaacgac
accactggtactctgatgtcgtgtgcttggaaaaacaggaattgtcgtatcggattgatc
gtcggaactggtaccaacgcctgttacgtggagaagacgtcgaacgtacaatgtgcgatt
ccaggaaacttctcgcaagagaagccacatatgctgatcaatatcgaatggggtgcgttc
ggtgagggtggtgtgctcgattttattctaacggagttcgatcgcgccatcgacgaaaat
tcgatcaatccgtcgaaacagttgtttgagaagatgatctcgggcatgtacatgggagaa
ttgacgaggttggttctcgagaaagtggtgaacgccgggctactgttcggtggaaagtgc
cccagcgatcttaagaaacggggcaaattcttcacgaaatacgtttcagaaatcgaaaac
gatgctaaagggaaatacacgaactgccgcgaagtactagcagaattaggattacgaaac
gtaagcgaccaggattgtgaaaacgttaggtacgtttgctctgttgtgtcgaggagagca
gctcacctggccagcgctggaatcgccacgttattgaacaaaatgggcgaagacagcgta
acagtcggaatcgatggttcggtctacagattccatccgtacttccacgagcttatgacc
gagaagataagccagttacagaattataagttcgatttaatgctctcggaggatggcagc
ggtcgtggtgcggcgctggtcgccgcagtggctgccggacaccggtga

DBGET integrated database retrieval system