KEGG   Bombus terrestris (buff-tailed bumblebee): 100649744Help
Entry
100649744         CDS       T04364                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00500  Starch and sucrose metabolism
bter01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bter00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100649744
Enzymes [BR:bter01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100649744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 100649744
NCBI-ProteinID: XP_003400146
LinkDB All DBs
AA seq 492 aa AA seqDB search
MLATATFLAVLVLAASGATNKDPHFVPGHDTIVHLFEWKWNDIAKECERFLGPMGYGGVQ
VSPLQENLKIANRPWWERYQPISYLWTTRSGTKEEFINMVGRCNKAGVRIYVDAILNHMS
GNLNDAHGTGISRADTYHYEYYQVPYHAQHFHKPCSVNNYNDPQNVRNCELTGLHDLDQS
QEYVRSKLVNFLNEAVDAGVAGFRIDAAKHMWPNDLNIIYSRIKNLNTRHGFPPNSKPYI
YQEVIDYGGEAISKREYNQQAAVIEFKYAAELSNSFRGNNLLKWFVNFGEQWGLLPSTDA
LVFVDNHDTQRDNQQILTYKSSKLYKMAVAFMLAHPFGTPRVMSSFDFQSKDQGPPHDGN
GNIISATINPDNSCGNGWICEHRWRQIYNMVRFRNVVNRTSIKNWWDNGSNQIAFCRGNS
GFVAFNNDRNDLKATLKTCLPPGQYCDVISGNLENRRCTGKVVNVQQNGDAYIEISKGEE
DGVLAIHVGAKL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgaccgcgacgtttttagctgtactcgtattggcagcgagtggagccacgaac
aaagacccccactttgttcctggccacgataccatcgtgcatcttttcgaatggaaatgg
aacgacattgcaaaggaatgcgaaagatttcttgggccaatgggatacggtggagtacag
gtatcaccattacaagagaatctgaagatcgctaacagaccatggtgggaacgttaccaa
ccaatttcctacttgtggactacgcgatccggcacgaaagaagaatttatcaatatggtt
ggaagatgcaacaaagctggtgtccgaatttacgtagacgctatcctgaatcacatgtcc
ggcaatttgaacgatgctcatggcactggaatctctagagcagacacgtaccattacgaa
tattatcaagtgccttaccacgctcaacatttccataaaccttgctcggttaacaactat
aacgatccgcagaacgtgcgaaattgcgaactgactggtcttcatgatttggatcagagt
caagaatacgtcagatcgaagctggtgaatttcttgaatgaagctgtcgacgctggtgtt
gctggtttccgaatcgatgctgccaagcatatgtggccaaacgacttgaacatcatttac
tcgagaataaagaacctgaacactcggcatggtttccctccaaattccaagccatacata
taccaagaagtgatcgattatggcggtgaggcaatttctaaacgcgaatacaaccaacag
gccgcggtaattgagttcaaatacgccgccgaactctccaactcgttccggggtaacaat
cttttgaaatggttcgtcaattttggagagcaatggggtcttttaccctctacagatgcc
ctcgttttcgtcgataatcacgacacacaacgtgacaatcaacaaatactcacttacaaa
tcatcaaaactgtacaagatggcggtcgccttcatgttagcccaccccttcggtacaccg
cgagtgatgagttccttcgacttccaaagcaaggatcaaggaccacctcatgatggaaat
ggcaatatcatatctgcaactatcaatccagacaacagttgcggcaatggttggatctgt
gaacaccgttggaggcaaatttacaacatggttcgcttccgcaatgtggttaatcgaacg
agcattaagaactggtgggacaatggcagcaatcagattgcattctgtcgtggaaattct
ggatttgttgcgtttaacaatgaccgcaatgatttgaaagccaccctcaagacctgcttg
cctcctggccaatactgtgacgtgatttctggtaacttggagaatagaagatgcactgga
aaggtcgttaacgtgcaacagaatggtgatgcttatatcgaaatctctaaaggagaggag
gatggagttcttgctattcacgttggggctaaactgtaa

DBGET integrated database retrieval system