KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_21065Help
Entry
YBT020_21065      CDS       T01839                                 

Definition
(GenBank) superoxide dismutase, Mn
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Brite
Enzymes [BR:btf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     YBT020_21065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ADY23441
UniProt: F0PX41
LinkDB All DBs
Position
complement(4103759..4104370)
Genome map
AA seq 203 aa AA seqDB search
MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVA
NLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGELATAIEAKFGSFDAFKEEF
AKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRP
DYIGAFWNVVDWNAAEKRYQEAK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacacgaattaccaaatttaccttatgcgtatgatgctttagagcctcacttt
gacaaagaaacaatgaacatccatcatacaaaacaccataacacgtacatcacaaactta
aacgctgctttagaaggtcatgcagaattagctgacaaaagcgtagaagaattagttgca
aacttaaacgaagtaccagaagcaatccgtacagcagtacgtaacaatggtggcggacat
gctaaccacacattcttctggacaatcttatctccaaacggcggcggacaaccagtaggc
gaacttgcaactgcaattgaagcgaaattcggtagcttcgatgcattcaaagaagaattc
gcaaaagctggcgcaactcgcttcggttctggttgggcttggttagtagtaaataatggt
gagttagaagtaacaagcacgccaaaccaagattctcctctaactgaaggtaaaactcca
gttatcggtttagatgtttgggaacatgcttactacttaaattatcaaaaccgtcgtcca
gactacatcggtgcattctggaacgttgtagattggaacgctgctgaaaaacgttaccaa
gaagcaaaataa

DBGET integrated database retrieval system