KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_4690Help
Entry
BT_4690           CDS       T00122                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BT_4690
Enzymes [BR:bth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BT_4690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6152762..6154207
Genome map
AA seq 481 aa AA seqDB search
MENGVMMQYFEWHLPNDGKLWKQIKEDALHLHDIGVTAVWIPPAYKADEQQDEGYATYDL
YDLGEFDQKGTIRTKYGTKDELKKMIDELHKYHIAVYLDVVLNHKAGGDFTEKFMVVEVD
PKERTKALGEPFEIQGWTGYSFHGRKDKHSDFKWHWYHFSGTGFDDAQKRSGVFQIQGEG
KAWSEGVDSENGNYDFLLCNDIDLDHPEVVSELNRWGKWVSNELNLDGMRLDAIKHMKDQ
FVAQFLDAVRSERGNDFYAVGEYWNGDLEALDAYIEAVGHKVNLFDVPLHYNMFQASQEG
KDYDLRDILKDTLVEHHPDLAVTIVDNHDTQRGSSLESNVEDWFKPLAYGLILLMKEGYP
CLFYGDYYGIKGEKSPHTRIIDILLDARRKYAYGDQIEYFDHPSTIGFIRTGDEEHNGSG
LVFLMSNDEAGSKIMSLGEKHKGEVWHEITGSISEEITLDEEGNGEFSVESRNLAVWVKK
D
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatggtgttatgatgcaatattttgaatggcatctcccgaatgacgggaagtta
tggaaacagataaaggaagatgcgttgcatcttcatgatataggtgtgactgctgtttgg
attccccctgcttataaggccgatgagcagcaagacgaaggatatgcgacttatgatctg
tatgacttgggcgaatttgaccaaaagggaaccataagaactaaatatggtacgaaagat
gaactgaagaaaatgattgacgaattgcacaaatatcatattgctgtttatctggacgtt
gtattgaatcataaagcgggtggtgattttactgaaaagtttatggtagtggaggtcgat
cccaaggagagaaccaaggctttgggtgagccgtttgagatacaagggtggaccgggtat
agctttcacggacgtaaggacaaacattcggattttaaatggcattggtatcatttttcc
gggacgggttttgatgatgcgcaaaagcgcagcggtgtttttcagatacagggagaagga
aaagcttggagtgagggcgtggatagtgagaacggtaattatgattttctgttatgtaac
gatattgacttggaccatccggaagttgtatctgaattgaaccgttggggaaagtgggtt
tccaatgaattgaatctcgacggaatgcgtctggatgccattaaacatatgaaagatcaa
ttcgtcgcacaattcctcgatgcggtgaggagtgaaagaggcaatgatttttatgccgta
ggtgaatattggaatggtgacctggaagcattggatgcttatatagaagctgttgggcac
aaagtaaacctatttgatgtcccgttacattataatatgttccaggcatcacaggaaggt
aaagactatgatttgcgggatattttaaaagatactctggttgaacatcatcccgatctg
gctgtaaccattgttgacaatcatgatacgcaacgcggaagttctcttgaatccaatgta
gaagattggtttaaaccgttggcttatggtttgattttgctgatgaaggaaggttatcca
tgtctgttttatggagattattatggtataaagggggagaagtctcctcatacccggatt
attgatatattgttggatgcgagacgaaagtacgcttacggtgatcagatagaatacttc
gaccatccttcaacgattggctttatccgtacaggagatgaggaacataatggctccggg
ctggtcttccttatgtctaatgacgaggcgggaagtaaaataatgagcttgggtgagaaa
cataaaggcgaagtctggcacgaaataaccggaagtatatccgaagaaataactttagat
gaagaaggaaatggagagttctctgtcgaatcccgtaacctggctgtttgggtgaagaag
gattag

DBGET integrated database retrieval system