KEGG   Bacillus thuringiensis serovar kurstaki HD-1: BTK_22565Help
Entry
BTK_22565         CDS       T03473                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bthi  Bacillus thuringiensis serovar kurstaki HD-1
Brite
Enzymes [BR:bthi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BTK_22565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(4385672..4386283)
Genome map
AA seq 203 aa AA seqDB search
MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVA
NLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGELATAIEAKFGSFDAFKEEF
AKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRP
DYIGAFWNVVDWNAAEKRYQEAK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacacgaattaccaaatttaccttatgcgtatgatgctttagagcctcacttt
gacaaagaaacaatgaacatccatcatacaaaacatcacaacacgtacattacaaactta
aacgctgctttagaaggtcatgcagaattagctgacaaaagcgtagaagaattagttgca
aacttaaacgaagtaccagaagcaatccgtacagcagtacgtaacaatggtggcggacat
gctaaccatacattcttctggacaatcctatctccaaacggcggaggacaacctgtaggt
gaacttgcaactgcaattgaagcaaaattcggtagcttcgatgcattcaaagaagaattc
gcaaaagctggcgcaactcgcttcggttctggttgggcttggttagtagtaaacaatggt
gagttagaagtaacaagcactccaaaccaagattctcctttaactgaaggtaaaacgcca
gttatcggtttagatgtttgggagcatgcttactacttaaactaccaaaaccgtcgtcca
gactacatcggtgcattctggaacgttgtagattggaacgctgctgaaaaacgttaccaa
gaagcaaaataa

DBGET integrated database retrieval system