KEGG   Burkholderia thailandensis USAMRU Malaysia #20: BTRA_2348Help
Entry
BTRA_2348         CDS       T03391                                 

Definition
(GenBank) glutathione S-transferase, N-terminal domain protein
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
bthm  Burkholderia thailandensis USAMRU Malaysia #20
Brite
Enzymes [BR:bthm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     BTRA_2348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:2607116..2607820
Genome map
AA seq 234 aa AA seqDB search
MSDLSEFPITKKWPAQHPDRIQLYSLPTPNGVKVSILLEETGLPYEAHVVRFDTNDQMSP
EFLSLNPNNKIPAIIDPHGPGGKPLALFESGAILLYLAEKTGQLIPADPARRYETIQWLM
FQMGGIGPMFGQLGFFHKFAGREYEDKRPRDRYVGEAKRLLGVLDGRLANRQWIMGDAYT
IADIATFPWVRNLIGFYEARELVEFDRYPNVARVLDAFVARPAVVRGLNVPARP
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatctctccgagttcccgatcacgaagaaatggcccgcgcagcatccggaccgc
atccagctctattcgctgccgacgccgaacggcgtgaaagtgtcgatcctgctggaggaa
acggggctgccgtacgaagcgcacgtcgtgcgcttcgacacgaacgaccagatgtcgccc
gagttcctgtcgctgaacccgaacaacaagatcccggcgatcatcgatccgcacggcccg
ggcggcaagccgctcgcgctgttcgaatcgggcgcgatcctgctgtatctcgccgagaag
acgggccagctcattccggccgatcccgcgcgccgctacgagacgatccagtggctgatg
ttccagatgggcggcatcgggccgatgttcggccagctcggcttcttccacaagttcgcg
ggccgcgagtacgaggacaagcgtccgcgcgaccgctacgtcggcgaggcgaagcgcctg
ctcggcgtgctcgacggccgcctcgcgaatcgccagtggatcatgggcgacgcctatacg
atcgccgatatcgcgactttcccgtgggtgcgcaacctgatcgggttctacgaggcgcgc
gagctcgtcgaattcgatcgctatccgaacgtcgcgcgcgtgctcgatgcgttcgtcgcg
cggccggcggtggtgcgcgggctgaacgttccggcgcggccgtaa

DBGET integrated database retrieval system