KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch4031Help
Entry
H175_ch4031       CDS       T02474                                 

Definition
(GenBank) Protein-glutamine gamma-glutamyltransferase
  KO
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Brite
Enzymes [BR:btht01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     H175_ch4031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3990016..3990846
Genome map
AA seq 276 aa AA seqDB search
MIVIGRSIVHPYITNEYEPFAAEKQQILSIMAGNQEVYSFRTADELSFDLNLRVNIIISA
LELFQSGFQFRTFQQSFCNPQYWKRTSLGGFELLPNIPPSIAIQDIFKNGKLYGTECATA
MIIIFYKALLSLYEEETFNRLFANLLLYTWDYDQDLRLITKTGGDLVPGDLVYFKNPQVN
PATIEWQGENTIYLGNFFFYGHGVGVKTKEEIIYSLNERRVPYAFISAFLTDTITRIDSR
IMSQYASSSTPQTSISFIPIRDDAIVATVGHTTTIY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaataggccgttctattgtacatccttatattacaaatgaatatgagccattt
gcagcagagaaacaacaaattttatcaataatggcaggaaatcaagaagtttattccttc
cgaacagctgatgaactcagctttgatctcaatttacgagttaatattattatctctgca
ctagaactttttcaaagtggatttcagtttcgcacatttcaacaatccttttgcaacccc
cagtattggaaaagaacatcccttggaggattcgagcttcttccaaacataccaccttct
attgccatacaagatattttcaaaaacggaaaactatatggaactgaatgcgcaaccgct
atgatcattattttttataaagctttattatcattgtatgaggaagaaactttcaatcgt
ctatttgcaaaccttttactttatacatgggactacgatcaagatctaaggctcataaca
aaaaccggtggcgatcttgttccaggtgacctcgtttactttaaaaacccacaagtgaat
ccagctacgattgagtggcaaggagaaaacacaatctatttaggaaatttctttttttac
ggacatggcgtaggtgtaaaaacaaaagaagaaattatttattcattaaatgaacgacga
gtcccttacgcttttatttcagctttcttgaccgatactattacccgtatagatagccgt
ataatgagccaatacgcttcttctagtacaccacagacatccataagctttattccaatt
agagatgatgcaatcgttgcaacagttggccatacaactacaatttattaa

DBGET integrated database retrieval system