KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch5459Help
Entry
H175_ch5459       CDS       T02474                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Pathway
btht00240  Pyrimidine metabolism
btht01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btht00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    H175_ch5459
Enzymes [BR:btht01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     H175_ch5459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 DZR UvrD-helicase zf-C4_ClpX
Motif
Other DBs
NCBI-ProteinID: AGG04168
UniProt: M1PTN9
LinkDB All DBs
Position
complement(5314976..5315563)
Genome map
AA seq 195 aa AA seqDB search
MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRYSEEDVVSHNG
LKVKAVPVSASKDIFEHITEDMDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDF
RGLPFGQVPQLMAIAEHVTKLQAVCSACGSPASRTQRLIDGEPAAFDDPIILVGASESYE
PRCRHCHAVPTNKDK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtacttaataaatcaaaatggctggattgaagtgatttgcggtagtatgttttctggt
aaatcagaagagttaatccgccgtgtgcgccgtacgcaatttgcgaaacaacatgcaatt
gtatttaaaccatgtattgataatcgctatagtgaagaagacgttgtatcacataacgga
ttaaaggtaaaagcagttcctgtttcagcttcaaaagatatatttgaacatatcactgaa
gatatggatgtaattgcaatcgatgaggtacaattctttgatggggacattgtggaagtg
gtgcaagtattggcaaatcgtggctatcgtgtcattgtagctggtttagaccaagatttc
cgtggtctaccatttggacaagttcctcagctgatggcgattgctgaacatgtaacaaag
ctacaagcagtatgttctgcatgtggatctccggcaagtcgtacacaacgattaattgat
ggagaaccagcggcatttgatgatccgattattttagttggggcttcagaatcgtatgag
ccacgctgtcgtcattgtcatgcagttcctacaaacaaagataagtaa

DBGET integrated database retrieval system