KEGG   Bacillus thuringiensis HD-771: BTG_02170Help
Entry
BTG_02170         CDS       T02293                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bti00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BTG_02170
Enzymes [BR:bti01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BTG_02170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
456518..458059
Genome map
AA seq 513 aa AA seqDB search
MFKRITIVGLSVVMLLPSIYGESKAYADTVNNGTLMQYFEWYAPNDGNHWNRLRADAENL
AEKGITSVWIPPAYKGTTQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIDALHK
KNIDVYGDVVMNHKGGADYTETITAVEVDPSNRNVEVSGDYEISAWTGFNFPGRGDSYSN
FKWKWYHFDGTDWDEGKKLNRIYKFRGIGKAWDWEVSSENGNYDYLMYADLDFDHPDVAN
EMKKWGTWYAKELNLDGFRLDAVKHIDHEYLRDWVNHVRQQTGKDMFTVAEYWQNDIQTL
NNYLAKGNYNQSVFDAPLHYNFHYASTGNGNYDMRNILKGTVVANHPTLAVTLVENHDSQ
PGQSLESVVSPWFKPLAYAFILTRAEGYPSVFYGDYYGTKGNSNYEIPALKDKIDPILTA
RKNFAYGTQRDYFDHPDVIGWTREGDSVHANSGLATLISDGPGGSKWMDVGKNNAGEVWY
DITGNQTNTVTINKDGWGQFQVSGGSVSIYVQQ
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaagaataacaatagtcggattgtcagttgttatgttattacctagtatatat
ggggagagtaaagcatatgcagatacagttaacaatggaacgttaatgcagtattttgag
tggtacgctccgaatgatgggaatcattggaatcgtttgcgtgctgatgctgaaaattta
gcggaaaaaggaattacatctgtttggataccacctgcatataaaggaactacgcaaaat
gacgtaggatatggagcatatgatttatatgatttgggggaattcaatcaaaagggaaca
gtgcggacgaaatatgggacgaaagcacaattgaaatctgccattgacgctttacataag
aaaaacatcgatgtatacggtgatgtagttatgaatcataaaggtggggctgattatacg
gaaactatcacagcagttgaggtagacccgagcaatcgaaatgttgaagtatcaggtgat
tatgaaattagtgcttggacaggctttaactttccagggcgtggagattcttattctaat
ttcaaatggaaatggtatcattttgacggaacagattgggatgaaggaaagaaattaaac
cgaatttataaatttaggggcataggtaaagcgtgggactgggaagtgtctagcgagaat
gggaattatgattatttgatgtacgcggatcttgattttgatcatccagatgttgcgaat
gaaatgaaaaaatggggaacgtggtatgcgaaggaattaaatttagatggctttcgttta
gatgctgttaaacatattgatcatgaatatttgcgcgattgggtaaatcatgttagacag
caaacggggaaagacatgtttacagtagctgaatattggcaaaatgatatccagacttta
aataattatttagcgaagggcaattataatcaatctgtgttcgatgcgccacttcattat
aattttcattatgcttcaacaggaaatggaaattatgatatgagaaatattttaaaagga
acggtagttgcgaatcatcctacacttgcggttactctagttgaaaatcatgattcacag
cctggtcagtcattggaatctgtagtgagcccttggttcaaaccgttggcatatgcattt
attttaacgcgtgcagagggatatccttctgttttctatggtgattactatggtacaaaa
ggaaatagtaactatgaaattccagcgttaaaggacaaaattgatccgattttgacggca
cgaaaaaactttgcatatggtacgcagcgggattattttgatcatccagatgtaattggc
tggacaagagaaggtgatagtgtacatgctaattctggtttagcaacgttaatctctgat
ggaccaggagggtcaaagtggatggatgttgggaagaataacgcaggggaagtatggtac
gatattacgggtaatcaaacaaatactgtaacaattaataaggacgggtgggggcagttc
caagtaagtggaggatcagtttccatatatgttcagcagtaa

DBGET integrated database retrieval system