KEGG   Bacillus thuringiensis MC28: MC28_2635Help
Entry
MC28_2635         CDS       T02263                                 

Definition
(GenBank) Glucan 1,4-alpha-maltohexaosidase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MC28_2635
Enzymes [BR:btm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MC28_2635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2572832..2574373)
Genome map
AA seq 513 aa AA seqDB search
MLKRITVVCLLFILLFPNIYGRNKAEAATINNGTLMQYFEWYVPNDGNHWNRLRSDAESL
AHKGITSVWIPPAYKGTSQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIDALHK
QNIDVYGDVVMNHKGGADYTENVTAVEVDRNNRNIEVSGDYEISAWTGFNFPGRRDAYSN
FKWKWYHFDGTDWDEGRKLNRIYKFRGIGKAWDWEVSSENGNYDYLMYADLDFDHPDVAN
EMKNWGKWYANELNLDGFRLDAVKHIDHEYLRDWVNHVRQQTGKEMFTVAEYWQNDIQTL
NNYLAKVNYNQSVFDAPLHYNFHYASTGNGNYDMRNILNGTVMKNHSALAVTLVENHDSQ
PGQSLESVVSPWFKPLAYAFILTRAEGYPSVFYGDYYGTSGNSSYEIPALKDKIDPILTA
RKNFAYGTQRDYLDHPDVIGWTREGDSVHAKSGLATLISDGPGGSKWMDVGKNNAGEVWY
DITGNQTNTVTINKDGWGQFHVSGGSVSIYVQQ
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaggattacggtagtctgtttattatttattttgctttttcctaatatatat
gggaggaataaggcagaagcagcaacgataaataatggaacattaatgcagtattttgag
tggtacgttccgaatgatgggaatcattggaatcgtttgcgttctgatgctgaaagttta
gctcataagggaatcacatctgtatggataccacctgcatataaagggacttcgcaaaat
gatgtagggtatggggcctatgatttatatgatttaggggagttcaatcaaaaaggaacg
gtgcggacgaaatatgggacaaaggcacagttgaaatctgcaattgacgctttacataaa
caaaacatcgacgtatatggtgatgtagttatgaatcataaaggtggggctgattatact
gaaaacgtaacagctgttgaggtagaccgtaacaatcgaaatattgaagtatcaggtgat
tatgaaattagtgcatggacgggttttaactttccggggcgcagagatgcttattctaat
tttaaatggaaatggtatcattttgacggaacggattgggatgaaggaaggaaattaaat
cgaatttataaatttaggggcataggtaaagcatgggactgggaagtgtctagcgaaaat
ggaaactatgattatttgatgtatgcagatcttgattttgatcatccagatgttgcgaat
gagatgaaaaattgggggaagtggtatgcgaatgaattaaatttagatggatttcgttta
gatgctgttaaacatattgatcatgaatatttacgcgattgggtaaatcatgtcaggcag
caaacggggaaagaaatgtttacggtggctgaatattggcaaaatgatatccagacttta
aacaattatttggcaaaagtcaattataatcaatctgtatttgatgcaccgcttcattat
aattttcattatgcttcaacaggaaatgggaattatgatatgagaaatattttaaatgga
acagtaatgaaaaatcactctgcactcgcagttactctcgttgagaatcatgattctcaa
cctgggcagtcattggaatctgtagtaagtccgtggtttaagccgctggcatatgcattt
attttaactcgtgcagagggctatccttcagttttctatggtgattactatgggacaagc
ggaaatagtagttatgaaattccagcgttaaaagataaaattgatccaattttgacggca
cgaaaaaactttgcatatggtacgcagcgtgattatttagaccatccagatgtgattggc
tggacaagagaaggcgatagtgtacatgctaagtctggtttagcgacattaatctccgat
ggaccaggaggatcaaagtggatggatgttggaaagaataacgctggggaagtatggtac
gatattacgggtaatcaaacaaatactgtaacaattaataaagatggatgggggcaattc
catgtaagtggaggctctgtttccatatatgttcaacagtaa

DBGET integrated database retrieval system