KEGG   Bacillus thuringiensis MC28: MC28_3567Help
Entry
MC28_3567         CDS       T02263                                 

Gene name
sodA1
Definition
(GenBank) superoxide dismutase, Mn
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
btm  Bacillus thuringiensis MC28
Brite
Enzymes [BR:btm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MC28_3567 (sodA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3463717..3464328)
Genome map
AA seq 203 aa AA seqDB search
MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVA
NLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGELATAIEAKFGSFDAFKEEF
AKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRP
DYIGAFWNVVDWNAAEKRYQEAK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacacgaattaccaaacttaccttatgcgtatgatgctttagagcctcacttt
gacaaagaaacaatgaacatccatcatacaaaacatcacaacacgtacattacaaactta
aacgctgctttagaaggtcatgcagaactagctgacaaaagcgttgaagaattagttgca
aacttaaacgaagtaccagaagcaatccgtacagcagtacgtaacaatggtggtggacat
gctaaccatacattcttctggacaattctttctccaaacggcgggggacaaccagtaggc
gaacttgcaactgcgattgaagcgaaattcggtagcttcgatgcattcaaagaagaattc
gcaaaagctggcgcaactcgcttcggttctggttgggcttggttagtagtaaacaatggt
gagttagaagtaacaagcacgccaaaccaagattctcctctaactgaaggtaaaactcca
gttatcggtttagatgtttgggagcatgcttactacttaaattaccaaaaccgtcgtcca
gactacatcggtgcattctggaacgttgtagattggaacgctgctgaaaaacgttaccaa
gaagcaaaataa

DBGET integrated database retrieval system