KEGG   Bacillus thuringiensis MC28: MC28_4934Help
Entry
MC28_4934         CDS       T02263                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
btm  Bacillus thuringiensis MC28
Pathway
btm00473  D-Alanine metabolism
btm00550  Peptidoglycan biosynthesis
btm01100  Metabolic pathways
btm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    MC28_4934 (ddlB)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MC28_4934 (ddlB)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    MC28_4934 (ddlB)
Enzymes [BR:btm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MC28_4934 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:btm01011]
 Precursor biosynthesis
  Amino acid ligase
   MC28_4934 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AFU16356
UniProt: K0FWF6
LinkDB All DBs
Position
4818627..4819712
Genome map
AA seq 361 aa AA seqDB search
MTKIKLGLLYGGKSAEHQVSLQTALAAIKALNQDKFEIHPIYITEQGQWVRGERIEGEVT
DVEALKMSGAENSISPLSLSTEIIPSATSEEDAIDVIFPLLHGPNGEDGTVQGLLELMNI
PYVGNGVLASSAGMDKVVMKNIFAEAGLKQAKYASFIRSAWEKNREEAYDKVEEKLGYPC
FVKPANLGSSVGINKCKNREELESAFEEAFQFDRKIIVEENIVGREVEVGVLGNDEPKCS
VVGEIVPKKDFYDYKSKYIDGDTALIIPAEMTEEESNVIKREAIVAFQSLDGAGLTRADF
FLTKDGEVYINEVNTMPGFTPFSMFPLLWQHTGLPYPELIEELIRLAIERHEEKQKIKYT
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgacgaaaattaaattaggtttattatatggtggaaaatcagctgagcatcaagtttcg
ttacagacggctcttgctgctattaaagcgttaaatcaagataaattcgagattcatccg
atttatattacagagcaaggtcaatgggtacgcggtgagcgtattgaaggtgaagtaacg
gatgttgaagctttaaaaatgagcggtgcagaaaattcgatttctccgttatcattaagc
acggaaattattccatctgcaacttctgaggaagatgctatcgacgttatttttccatta
ctacatggaccaaatggtgaagatggaacggttcaagggttattagaattaatgaacatt
ccttatgtaggaaatggtgttctagcatcatctgccggtatggataaagttgttatgaaa
aatatctttgcagaagctggtttgaaacaagcgaaatatgcatctttcattcgtagtgca
tgggaaaaaaatcgcgaagaagcttatgacaaagtagaagagaagttagggtatccttgc
ttcgtaaaaccagcaaaccttggttcaagtgttggtattaataaatgtaaaaatcgtgaa
gaacttgagagtgcatttgaagaggcattccaattcgaccgcaaaattattgtagaagaa
aatatcgtaggtcgtgaagtagaagttggtgtactaggtaacgacgaaccgaaatgttca
gttgtaggtgaaatcgtaccgaaaaaggacttttatgattataagtcgaagtacatcgat
ggtgatacagcgttaattattccagctgaaatgacagaagaagagtctaatgtaattaag
cgagaggcaattgttgcattccaatctttagatggtgcaggcttaacgcgagctgatttc
ttcttaacgaaagacggagaagtatatattaacgaagtaaacacaatgccaggatttacg
ccgtttagtatgttccctctattatggcaacatactggattaccatatccagaattaatc
gaagagctaattcgtttagcgattgaacgtcacgaagaaaaacaaaaaattaaatataca
atataa

DBGET integrated database retrieval system