KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_2730Help
Entry
WQG_2730          CDS       T02504                                 

Definition
(GenBank) Elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Brite
Translation factors [BR:bto03012]
 Eukaryotic Type
  Elongation factors
   WQG_2730
 Prokaryotic Type
   WQG_2730
Mitochondrial biogenesis [BR:bto03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    WQG_2730
Exosome [BR:bto04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   WQG_2730
  Exosomal proteins of breast cancer cells
   WQG_2730
  Exosomal proteins of colorectal cancer cells
   WQG_2730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
259100..260308
Genome map
AA seq 402 aa AA seqDB search
MFKGNLKMAKEQFNRGDKVHVNVGTIGHVDHGKTTLTAAITTVLAKHFGGAARAFDQIDN
APEEKARGITINTSHVEYETATRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGP
MPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYEFPGDDTPIVR
GSALQALNGVPEWEEKILELAGHLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRV
ERGIIKSGEEVEIVGIKETTKTTVTGVEMFRKLLDEGRAGENVGALLRGTKREEIERGQV
LAKPGSITPHTDFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVM
PGDNIKMTVNLIHPIAMDEGLRFAIREGGRTVGAGVVAKIIK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaaaggaaacttaaaaatggcaaaagaacagtttaaccgtggtgataaagtccac
gtaaacgtgggtacaatcggtcacgttgaccatggtaaaaccactttaacagcagcaatt
actaccgttttagcaaaacacttcggtggtgcagctcgtgcattcgaccaaatcgacaat
gcaccagaagaaaaagcgcgtggtatcaccatcaacacttcacacgttgaatacgaaacc
gcaactcgtcactatgctcacgttgactgcccaggacacgcggactatgtgaaaaacatg
atcaccggtgcggcacaaatggacggcgctatcttagtagtagcagcaacagacggtcct
atgccacaaactcgtgagcacatcttattaggtcgccaagtaggtgttccatacatcatc
gtattcttaaacaaatgcgatatggtagatgacgaagagttattagaattagttgaaatg
gaagttcgtgaacttctttctcaatacgaattcccaggtgatgacacaccaatcgtacgt
ggttctgcgttacaagcattaaacggcgtaccagagtgggaagaaaaaatccttgaatta
gcaggtcacttagattcttacattccagagccagagcgtgcgattgataaaccattctta
ttaccaatcgaagacgtattctcaatctctggtcgtggtactgtagtaacaggtcgtgtt
gagcgtggtatcatcaaatcaggtgaagaagttgaaatcgtaggtatcaaagaaaccacc
aaaacaactgtaactggtgttgaaatgttccgtaaattacttgacgaaggtcgtgcaggt
gaaaacgtaggtgcattattacgtggtaccaaacgtgaagaaatcgaacgtggtcaagta
cttgctaaaccaggttcaatcacgccacacacagacttcgaatcagaagtttacgtatta
tcaaaagaagaaggtggtcgtcacactccattcttcaaaggttaccgtccacagttctac
ttccgtacaactgacgtaacaggtacaatcgagttaccagaaggtgttgaaatggtaatg
ccaggcgacaacatcaaaatgactgtaaacttaattcacccaatcgcaatggacgaaggt
ttacgttttgcaattcgtgaaggtggtcgtacagtaggtgcgggcgttgtagcgaaaatc
atcaaataa

DBGET integrated database retrieval system