KEGG   Burkholderia thailandensis MSMB59: BTHA_3178Help
Entry
BTHA_3178         CDS       T03416                                 

Definition
(GenBank) iron/manganese superoxide dismutase, alpha-hairpin domain protein
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
btv  Burkholderia thailandensis MSMB59
Brite
Enzymes [BR:btv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BTHA_3178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:complement(3493960..3494538)
Genome map
AA seq 192 aa AA seqDB search
MAHTLPPLPYAEDALAPHISQETIQYHYGKHHQAYVTNLNNLIPGTEFENLSLEEIVKKS
SGGIFNNAAQIWNHTFFWNSLSPNGGGAPTGALGDAINAKWGSFDAFKEAFTKAAVGTFG
SGWAWLVKKADGSLDIVSTSNAATPLTTADKPLVTIDVWEHAYYIDYRNARPKFVEAFWN
IVNWDFAAKNFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggctcatacgctcccgccgttgccgtacgctgaagacgccctcgctccgcacatctcg
caggagacgatccagtatcactacggcaagcatcaccaggcttatgtgacgaacctgaac
aacctgatccccggcaccgagttcgagaacctgtcgctggaagagatcgtgaagaagtcg
tcgggcggcatcttcaacaacgccgcgcaaatctggaatcacacgttcttctggaacagc
ctgtctccgaacggcggcggcgcgccgactggcgcgctcggcgacgcgatcaacgcgaag
tggggctcgttcgacgcgttcaaggaagcgttcacgaaggcggcggtcggcacgttcggc
tcgggctgggcgtggctcgtgaagaaggcggacggctcgctcgacatcgtgtcgacgagc
aacgcggccacgccgctcacgacggccgacaagccgctcgtcacgatcgacgtgtgggag
cacgcttactacatcgattaccgcaacgcgcgtccgaagttcgtcgaagcgttctggaac
atcgtgaactgggatttcgccgcgaagaacttcgcataa

DBGET integrated database retrieval system