KEGG   Bacillus toyonensis: Btoyo_4636Help
Entry
Btoyo_4636        CDS       T02901                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
bty  Bacillus toyonensis
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bty00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Btoyo_4636
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Btoyo_4636
Enzymes [BR:bty01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Btoyo_4636
Peptidoglycan biosynthesis and degradation proteins [BR:bty01011]
 Precursor biosynthesis
  Racemase
   Btoyo_4636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
4565533..4566759
Genome map
AA seq 408 aa AA seqDB search
MKREIEWNAIIELGVRPMSLKYGRDTIVEVDLNAVKHNVKEFKKHVNDENIAMMAAVKAN
GYGHGAVEVAKAAIEAGVNQLAVAFVDEAIELREAGITVPILILGYTSVAAAESAIQYDV
MMTVYRIEDLQGINEIAQRLQNKARIQVKIDTGMSRIGLQEEEVKPFLEELNRMEYVEVV
GMFTHYSTADEIDKSYTNMQTSLFEKAVNTANELGMQIPYIHSSNSAGSMELSNTFQNMV
RVGIGVYGMYPSKEVDHTVVSLQPALSLKSKVAHVKHATKNRGVSYGNTYVTTGEEWIAT
VPIGYADGYNRQLSNKGYALINGVRVPVIGRVCMDQLMLDVTKAMPVQVGDDVVFYGKQG
EEEIAVEEVADMLSTINYEVTCMLDRRIPRVYKENNETTAVVNILRKN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgaaatagaatggaatgcaattattgagttaggagttagaccaatgagtttg
aaatatggaagagatacaattgttgaagttgacttaaatgctgtaaaacataatgtaaaa
gaatttaaaaaacatgtaaacgatgaaaatattgcaatgatggctgctgtaaaagcgaat
gggtatggccatggggcagttgaagttgcgaaagctgcgattgaagcaggggtgaaccag
cttgcagttgcatttgtcgatgaagcgatcgaattaagagaagctggaatcactgtacca
atcttaatattgggttatacatcagttgcagctgcggaatccgcaattcaatatgacgtt
atgatgacagtctatagaatagaagatttacaaggcataaatgaaattgcacaacgtctt
caaaataaagcacgtattcaagtgaaaatcgatacaggaatgagccgtatcggtttgcaa
gaagaagaagttaaaccatttttagaagaattaaaccgtatggagtatgtagaggtagta
gggatgtttacacattactctacggcagatgaaattgataaatcgtatacgaatatgcaa
acaagtttatttgagaaagctgtaaatacagcaaatgaattagggatgcaaataccatac
attcatagttcaaatagtgcagggtcaatggaactaagcaatacatttcaaaatatggtt
cgcgttggtattggagtttacggcatgtatccttcgaaagaagtggatcatacagtcgtt
tccttacagcctgcattgtcattaaaatcaaaagtagctcatgttaaacatgcgacgaaa
aatcgtggtgttagttatggaaatacgtatgtaacaacgggtgaagaatggattgcgact
gtgccgattggttatgctgatggctataatcgccagttatctaataaagggtatgcatta
attaatggagttcgagtgccggttattggtcgtgtttgtatggatcagcttatgctggac
gttacaaaagcgatgccagtacaagtaggggacgatgtggtattttacggcaaacaaggt
gaagaagaaattgctgtagaagaagtagcggatatgttgagcacaattaattatgaagtt
acatgtatgttagacagaagaattcctcgtgtttataaagaaaataatgaaacgactgcg
gttgtaaatatattaagaaaaaactga

DBGET integrated database retrieval system