KEGG   Burkholderia thailandensis H0587: BTL_3730Help
Entry
BTL_3730          CDS       T03113                                 

Definition
(GenBank) acyltransferase family protein
Organism
btz  Burkholderia thailandensis H0587
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:432982..435819
Genome map
AA seq 945 aa AA seqDB search
MEHTQRLSDNATRLLALIDALLAELYGERNGHGRATLDARFERDLGFDSLTRAELFDRIE
RAFGVRLPVDVFASAATPADVVRALAAAHAQPQAAPEGEAGPAPPADAAAWPVEADTLID
VLNWHAERHPDRVHLRLLEDGLVATPLTYGELHRRASDLAGGLRERGIDPGDTVALMLPT
GLDYFVSFTAVLFCGAIPVPIYPPANPAQLEEHVERHTPILENARIKALIAFRQAVSVAQ
LLKLRVSTLQHVFTPEQLVGRERLPPFRAAASDIALLQYTSGSTGTPKGVVLSHANLLAN
IRAMGDRMHVYATDVLVSWLPLYHDMGLIGAWLAPLYFGIPAVVMSPVAFLARPALWLRA
ISRYHGTITAAPNFAYERCARHLAALEPTEFDLSSLRFAFCGAEPVNADTLRAFAARFAA
CGFDARALTPVYGLAENTLGLTFPPPARGLHVDRIARAPLNASGQAVPAPGDANALDVPG
CGYPIDGTELRIVGDDERELAERRVGRIEFRGTSATRGYYRNPAQTTRLFHDAWRDTGDL
GYVADGELYITGRAKDMIIRGGQHFFPYELEEAIGRLPGVAAGGVAVCGAADPASGTERV
VIFVESEAADGAACERLRASVNDVTAARWGMPAEQVSIVAPHSILKTPSGKIRHAATLAQ
FERCAGRLPQASAPWRQFADLAVRSVAPFCSRVSRRAARALRGLCCWALVALLAPVLWVR
VAYRNDTRDNWRLAAQACRAFLRFADVRASLIADPDALAAGPSIVVANHTSYLDVVALLA
LLPSPVHFVAKRELATRPFVGRFLRALGTRFVERRDYGRSVEDEARLVAQAAADETLLFF
PEGTFTRAAGLAAFRLGAFRAACIARRPVVPVVVSGARAVLRDGEWAPRRGEIAVTMLAP
IFPDGTDFGAMARLRDRARDAILSRCGEPDLRADRAPRAAFASVA
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
atggaacacacgcagcgcctatccgacaacgcgacgcgtctgctcgcgctgatcgacgca
ttgctcgccgagttgtacggcgagcgaaacggtcatggccgcgcgacgctcgatgcgcgg
ttcgagcgcgatctcggcttcgacagcctgacgcgcgcggagctgttcgaccggatcgag
cgcgcgttcggcgtgcgcttgccggtcgacgtgttcgcgtccgccgcgacgcccgccgac
gtcgtgcgcgcgctcgccgcagcgcacgcgcagccgcaggccgcgccggaaggcgaagcg
gggccggcgccgcccgccgatgccgccgcatggcccgtcgaggccgacacgctgatcgac
gtgttgaactggcatgccgagcggcatccggatcgcgttcatctgcggcttctcgaagac
ggcctcgtcgcgacgccgctcacttacggcgaactgcatcggcgcgcgtcggatctggcg
ggcggcttgcgcgagcgcggcatcgatccgggcgacacggtcgcgctgatgctgccgacg
gggctcgactatttcgtctcgttcaccgccgtcctgttttgcggcgcgatcccggtgccg
atctatccgcccgcgaatcccgcgcagctcgaagagcatgtcgagcgccacacgccgatt
ctcgagaacgcccggatcaaggcgctgatcgcgtttcgccaggccgtctcggtcgcgcaa
ttgctgaagcttcgcgtgagcacgctgcagcacgtgttcacgcccgagcagctcgtcggc
cgcgagcggctgccgccgtttcgcgcggccgcgagcgacatcgcgctgctccagtacacg
tcgggcagcaccggcacgccgaagggcgtggtgctcagccatgcgaacctgctcgcgaac
atccgcgcgatgggcgaccggatgcatgtctacgcgaccgacgtgctcgtgagctggttg
ccgctgtatcacgacatgggattgatcggcgcatggctcgcgccgctttatttcggcatt
ccggcggtcgtgatgtcgcccgtcgcgttcctcgcgcgtccggcgctgtggctgcgcgcg
atctcgcgataccacggcacgatcaccgccgcgccgaacttcgcgtacgaacggtgcgcg
cgccatctcgccgcgctcgagccgaccgaattcgatctgtcgtcgctgcgtttcgcattc
tgcggcgccgagcccgtcaacgccgacacgctgcgcgcgttcgcggcgcgcttcgccgcg
tgcggtttcgacgcgcgcgcgctgacgcccgtctacggtctcgcggaaaacacgctcggc
ctgacgtttccgccgcccgcgcgcgggctgcatgtcgatcggatcgcccgcgcgccgctc
aacgcgagcggccaggcggtgcccgcgcccggcgacgcgaacgcgctcgacgtgccgggc
tgcggctatccgatcgacggcaccgagctgcggatcgtcggcgacgacgagcgcgagctt
gccgagcggcgggtggggcgcatcgagtttcgcggcacgtcggcgacgcgcggctactac
cgcaatccggcgcagaccacgcgcctgttccatgacgcatggcgcgacaccggcgacctc
ggctatgtcgcggacggcgagctgtacatcaccgggcgcgcgaaggacatgatcatccgc
ggcggccagcatttctttccgtacgagctcgaggaggcgatcggacggctgccgggcgtc
gcggcgggcggcgttgcggtgtgcggcgccgccgaccccgccagcggcaccgagcgcgtc
gtgatcttcgtcgagagcgaggccgccgacggcgccgcgtgcgagcggctgcgggcgagc
gtcaacgacgtgacggccgcgcgctggggcatgcccgccgaacaggtgagcatcgtcgcg
ccgcacagcatcctgaagacgccgagcggcaagatccgccacgcggcgacgctcgcgcag
ttcgagcgctgcgccggacggttgccgcaagcgagcgcgccgtggcggcaattcgccgat
ctggcggtgcgcagcgtcgcgccgttctgctcgcgcgtgtcgcggcgcgcggcgcgggcg
ctgcgcgggctgtgctgctgggcgctcgtcgcgctgctcgcgcccgtgctgtgggtgcgc
gtcgcgtatcggaacgatactcgggacaactggcggctcgcggcgcaagcgtgccgcgcg
ttcctgcgtttcgccgacgtgcgcgcgagcctgatcgccgatcccgacgcgctcgcggcc
gggccgtcgatcgtcgtcgcgaaccataccagctacctggacgtcgtcgcgctgctggcg
ttgctgccgagtcccgtgcacttcgtcgcgaagcgcgagctcgcgacgcgcccgttcgtc
ggccgcttcctgcgcgcgctcggcacgcgcttcgtcgagcggcgcgattacgggcgcagc
gtcgaggacgaagcgcggctcgtcgcgcaggcggccgccgacgagacgctgctgtttttt
ccggaaggcacgttcacgcgcgcggcggggctcgccgcgttccgcctcggcgcgtttcgc
gcggcgtgcatcgcgcggcggccggtggtgcccgtcgtcgtgagcggcgcgcgcgccgtg
ttgcgcgacggcgaatgggcgccgcgccgcggggagatcgcggtgacgatgctcgcgccg
atcttcccggacggcacggacttcggcgcgatggcgcggcttcgcgatcgcgcgcgcgat
gcgattctgtcgcgctgcggcgagcccgacttgcgggccgatcgcgctccgcgcgcggcg
ttcgcgtcggtcgcgtaa

DBGET integrated database retrieval system