KEGG   Burkholderia ubonensis: BW23_2460Help
Entry
BW23_2460         CDS       T03794                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bub  Burkholderia ubonensis
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bub00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BW23_2460
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BW23_2460
   00680 Methane metabolism
    BW23_2460
Enzymes [BR:bub01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BW23_2460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
I:complement(2643715..2646738)
Genome map
AA seq 1007 aa AA seqDB search
MKSSGSARAARRNAALPSSDAQTGSIAAAANGRAKSATQPATKPKDPIRQTKRAAKAVAN
GAAAVAAKPGARTREDKDRPLFEDIRFLGRLLGDVVREQEGDAVFDVVETIRQTAVKFRR
EDDREAAQTLEKKLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQP
GTVAFALDQLKQAGGASKGVLQRFFDDALIVPVLTAHPTEVQRKSILDAQHDIARLLAER
DQELTARERQHNEAMLRARVTALWQTRMLRDARLTVGDEIENALSYYRATFLDELPALYG
DIEAALAEHGLPARVPAFFQMGSWIGGDRDGNPNVTATTLDEAIHRQSAVILEHYLEQVH
KLGAELSVSNLLVGASDAVKALAAASPDQSPHRVDEPYRRALIGIYTRLAASARVRLGEG
TVPVRSAGRGAAPVRATPYADSEEFVRDLKVLMESLDEHHGASLAAPRLAPLARAAEVFG
FHLASIDLRQSSDIHEAVVAELLARAGVEADYAALAEEDKLRVLLAALADPRPLRSPYFE
YSALAQSELGVFEKARAVRAQFGPRAVRNYIISHTETVSDLVEVLLLQKETGLLDGAFGA
KHGGAKNGLMVIPLFETIPDLRDASRIMREYFALPGVDALVAHQGGEQEVMLGYSDSNKD
GGFLTSNWELYRAELALVDLFHERGITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQ
IRLTEQGEVIASKFANPEIGRRNLETVVAATLEASLLPQSNAPAQLPAFEAAMQTLSDTA
MAAYRALVYETPGFTDYFFSSTPITEIAELNIGSRPASRKLQDPKHRRIEDLRAIPWGFS
WGQCRLLLTGWYGFGSAVAAYLDGTKDAAERSKRLALLKKMNKTWPFFSNLLSNMDMVLA
KTDLAVASRYAQLVADKKLRKHVFERIVAEWERTSQALAEITGQDTRLATNPLLARSIKN
RFPYLDPLNHLQVELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 3024 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgcgcggcgcgccgcaatgctgccttgccctcctccgac
gcccagacgggctccatcgccgccgccgcgaacggtcgcgcgaaatcggcaacccagccg
gcaacgaaaccgaaagacccgatacgacagacgaaacgcgcggccaaggccgtcgcgaac
ggcgcggccgccgtcgcggcgaagccgggcgcccgcacccgcgaggacaaggaccgcccg
ctgttcgaggacatccgcttcctcggccgcctgctcggcgacgtcgtgcgcgagcaggaa
ggcgacgcggtgttcgacgtcgtcgagacgatccgccagaccgcggtgaaattccgccgc
gaggacgaccgcgaggccgcgcagacgctcgagaagaaactgcgcaagctgacgcccgag
cagacggtgagcgtcgtgcgcgcgttcagctatttctcgcacctcgcgaacatcgccgag
gaccgccaccacaaccgccgccgccgcatccacgcgctcgccggctccgcgccgcagcct
ggcaccgtcgcgttcgcgctcgaccagctgaagcaggcgggcggcgcgtcgaagggcgtg
ctgcagcgcttcttcgacgacgcgctgatcgtgcccgtgctcaccgcgcacccgaccgag
gtgcagcgcaagagcatcctcgacgcgcagcacgacatcgcgcggctgctcgccgagcgc
gaccaggagctgaccgcgcgcgagcgccagcacaacgaggcgatgctgcgcgcgcgcgtg
accgcgctgtggcagacgcggatgctgcgcgacgcgcgcctgaccgtcggcgacgagatc
gagaacgcgctgtcgtactaccgcgcgacgttcctcgacgagctgcccgcgctgtacggc
gacatcgaggccgcgctcgccgagcacggcctgcccgcccgcgtgccggcattcttccag
atgggcagctggatcggcggcgaccgcgacggcaacccgaacgtgaccgcgacgacgctc
gacgaggcgatccaccgccagtccgcggtgatcctcgagcactacctggaacaggtgcac
aagctcggcgccgagctgtcggtgtcgaacctgctggtcggcgcgagcgacgcggtgaag
gcgctcgccgccgcatcgcccgaccagtcgccgcaccgcgtcgacgagccgtaccgccgc
gcgctgatcggcatctacacgcggctcgcggcgagcgcgcgcgtgcgcctcggcgaaggc
acggtgccggtgcgcagcgccgggcggggcgccgcgcccgtgcgcgcgacgccgtacgcc
gattccgaggaattcgtgcgcgacctgaaggtgctgatggaatcgctcgacgagcatcac
ggcgcgtcgctcgccgcgccgcgcctcgcgccgctcgcgcgcgcggccgaggtgttcggc
tttcacctcgcgagcatcgacctgcggcagagctccgacatccacgaggcggtcgtggcc
gagctgctcgcccgcgcgggcgtcgaggccgactacgcggcgctcgccgaggaagacaag
ctgcgcgtgctgctcgccgcgctcgccgatccccgcccgctgcgctcgccgtacttcgaa
tactcggcgctcgcgcaaagcgagctcggcgtgttcgagaaggcgcgcgcggtgcgcgcg
cagttcggcccgcgcgcggtgcgcaactacatcatttcgcataccgagacggtcagcgac
ctcgtcgaggtgctgctgctgcagaaggaaaccggcctgctcgacggcgcgttcggcgcg
aagcacggcggcgcgaagaacggcctgatggtgatcccgctgttcgagacgatccccgac
ctgcgcgacgcgtcgcggatcatgcgcgagtacttcgcgctgccgggcgtcgacgcgctc
gtcgcgcaccagggcggcgagcaggaagtgatgctcggctactcggacagcaacaaggac
ggcggcttcctcacgtcgaactgggagctgtaccgcgcggagctcgcgctcgtcgacctg
ttccacgagcgcggcatcacgctgcgcctgttccacggccgcggcggcacggtcggccgc
ggcggcggcccgacctaccaggcgatcctgtcgcagccgcccggcaccgtgaacggccag
atccgcctgaccgagcagggcgaggtgatcgccagcaagttcgcgaacccggaaatcggc
cgccgcaacctggagacggtcgtcgccgcgacgctcgaggcgtcgctgctgccgcagtcg
aacgcgcccgcgcagctgcccgcgttcgaggcggcgatgcagacgctgtccgacaccgcg
atggccgcgtaccgcgcgctcgtctacgagacgcccggcttcaccgactacttcttctcg
tcgacgccgatcaccgagatcgccgagctgaacatcggcagccgtcccgcgtcgcgcaag
ctgcaggacccgaagcatcgccgcatcgaggacctgcgcgcgattccgtggggcttctcg
tggggccagtgccggctgctgctgaccggctggtacggcttcggcagcgcggtcgccgcg
tatctcgacggcacgaaggacgcggccgagcgcagcaagcggctcgcgctgctgaagaag
atgaacaagacctggccgttcttctcgaacctgctgtcgaacatggacatggtgctcgcg
aagaccgatctcgcggtcgcgtcgcgctacgcgcagctcgtcgccgacaagaagctgcgc
aagcacgtgttcgagcggatcgtcgccgaatgggagcgcacgtcgcaggcgctggccgag
atcaccggccaggacacgcggctcgcgacgaacccgctgctcgcgcgttcgatcaagaac
cgcttcccgtatctcgatccgctcaaccacctgcaggtcgagctgatcaagcggcaccgc
gcgggcgacaccaacgcgcggctgcggcgcgggattcacctgaccatcaacgggatcgcg
gcgggcctgcgcaacacgggctga

DBGET integrated database retrieval system