KEGG   Burkholderia sp. RPE67: BRPE67_DCDS11000Help
Entry
BRPE67_DCDS11000  CDS       T03604                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bue  Burkholderia sp. RPE67
Pathway
bue00010  Glycolysis / Gluconeogenesis
bue00620  Pyruvate metabolism
bue01100  Metabolic pathways
bue01110  Biosynthesis of secondary metabolites
bue01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bue00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRPE67_DCDS11000
   00620 Pyruvate metabolism
    BRPE67_DCDS11000
Enzymes [BR:bue01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BRPE67_DCDS11000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: BAO92255
UniProt: A0A060PF79
LinkDB All DBs
Position
p1:complement(1179941..1181461)
Genome map
AA seq 506 aa AA seqDB search
MNHAEMQFLSTEYPYKKQYGNFIGGKWVPPAGGEYFDNISPITGEPFTSIPRSREADIEA
ALDAAHAAKAAWGRTSVTDRANLLLKLADRMEQNLARLAVAESIDNGKPLRETMAADIPL
AIDHFRYFASAARSQEGGISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASILVLLEVIEGILPPGVLNVVNGFGLEAGKPLASNKRIAKIAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFEDVLNADDSFFDKALEGFTMFALNQGEV
CTCPSRALVQESIYERFMERALKRVAAIAQGHPLDTKTMIGAQASREQLEKILSYIDLGK
QEGAECLSGGERAAFDGELANGYYVKPTVFKGHNKMRIFQEEIFGPVLSVTTFKTEEEAL
DIANDTLYGLGAGVWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNMLVSYSDKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcagagatgcagtttctgagcaccgaatatccgtataaaaagcagtacggc
aacttcatcggcggcaagtgggtcccgcccgcgggcggcgagtatttcgacaacatctcg
ccgatcacgggcgaacctttcacgtcgattccgcgttcgcgcgaagccgacatcgaagcc
gcgctcgatgcggcgcatgcggccaaggctgcgtggggccggacctccgtcaccgatcgc
gcgaacctgctgctcaagctcgccgatcgcatggagcagaacctggcgcggctcgcggtg
gccgaatccatcgacaacggcaagccgctgcgcgagacgatggccgcggacattccgctc
gccatcgatcacttccgctacttcgcgagcgcggcgcgttcgcaggaaggcggcatttcg
gagatcgatcacgatacggtcgcgtatcacttccatgagccgctcggcgtcgtcggacag
atcattccgtggaatttcccgattttgatggccgtgtggaagctcgcgcccgcgctcgcg
gcgggcaactgcgtcgtgctgaagcccgcggagcaaacgcccgcgtcgattctcgtgctg
ctcgaagtgatcgaaggcattctgccgccgggcgtgctcaacgtcgtgaacggtttcggt
ctggaagcgggcaagccgctcgcgtcgaacaagcgcatcgcgaagatcgccttcaccggc
gagaccacgacgggccggctcatcatgcagtacgcgagccagaacctgattccggtcacg
ctggaactgggcggcaagagcccgaatatcttcttcgaggacgtgctgaacgccgacgac
agcttcttcgacaaggcgctcgaaggcttcacgatgttcgcgttgaatcagggcgaagtg
tgcacgtgcccgtcgcgcgcgctggtgcaggaatcgatctacgagcgtttcatggaacgg
gcgctcaagcgcgtcgcggccatcgcacagggccatccgctcgatacgaagacgatgatc
ggcgcgcaggcttcgcgggagcaactcgaaaagatcctgtcgtatatcgatctcggcaag
caggaaggcgcggagtgtttgagcggcggcgagcgcgcggccttcgacggcgaacttgcg
aacggctattacgtcaagccgaccgtcttcaaaggccacaacaagatgcgcattttccag
gaggaaatcttcgggccggtgctctcggtgacgaccttcaagaccgaggaagaggcgctc
gacatcgccaacgacacgctctacggtctcggcgcgggcgtgtggacgcgcgacggcacg
cgtgcctaccggttcggccgcgcgattcaggcgggccgcgtgtggactaattgctatcac
gcttatccggcgcacgcggcgttcggcggctacaagcagtcgggcatcgggcgcgagaat
cacaagatgatgctcgatcactatcagcagacgaagaacatgctcgtcagttatagcgac
aagccgctcggcttcttctaa

DBGET integrated database retrieval system