KEGG   Burkholderia sp. KJ006: MYA_5305Help
Entry
MYA_5305          CDS       T02110                                 

Definition
(GenBank) ATP-dependent DNA ligase clustered with Ku protein, LigD
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
buk  Burkholderia sp. KJ006
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:buk00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    MYA_5305
Enzymes [BR:buk01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MYA_5305
DNA repair and recombination proteins [BR:buk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     MYA_5305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3:284079..287072
Genome map
AA seq 997 aa AA seqDB search
MAGKLDPYRRKRHFDATPEPDGAGARRRAKPQPQPDGRAAPRRPLRFVIQEHHARRLHYD
FRLELDGTLKSWAVPKGPSFDPAVKRLAVHVEDHPVEYASFEGQIPAGHYGAGSVVVWDE
GTWTPDGGVAGARSGYRAGKLTFRLDGEKLHGGWALVRSGRQEGRQEQWLLIKERDEAAR
SADEFDVVGERSGSVHDGEGGASSAAGGAGADSHDATARTGGGGPSKRATQTGKRAARSG
ERAARAAKRADDRDRATARAHVRDGDRAAASDGAAARDPGAASIRASTGDADRTPRRTRT
PGRASAGDRDPSTVEGAVRAPLPERIAPQLATLVDAPPADADWRYELKFDGYRILARIAG
KGARRHVKLMTREGRDWTAKLRAQREALAALPVDDAWLDGEAVVLGANGLPDFQALQNAF
GAGQSDDVTLFVFDLPYLDGYDLRDAPLAARRALLEPLVADSDPTRLRFSPDLGDDVASL
IASACDTGLEGLIGKRAESRYRGGRSAAWIKLKCRRRQEFVIGGYTEPSGSRHGFGALLL
GVHDAPPAGKRSRAAAPLRYVGRVGTGFDARALDRLAALLRRHERDTTPFEPAPRERTRT
RVHWVEPTLVAECEFAEWTGDGIVRQAAFIALRDDKPATQIVREMPKHMETEGAMERQQS
TPDAGHERKRASRAADDTGKRKPNARASASARNAREDGDSDAELSARVRITHPERVLDPA
SGTRKIDLARYWQWVAPWLLPDLKGRPVSLVRAPGDITGELFFQKHAERREIPFVTQHPG
LDPGHGALLSLDSVDALLGAAQMGTIELHTWNAHASNIERPDRIVFDLDPDPALPWSAMI
EAAQLVRGLLDELGLRSFCKTSGGKGLHVVVPITRHMGWDDVKAFSRALAQHVAGALPER
FTATMGPRHRRGKIFIDYLRNGRGASTIAAYSVRARPGLGVSVPLHWDEVPDTTGGAQWT
IDTLHERLERLKRDPWEGYDDTRQRITAQMRARLDGA
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaagctcgatccgtatcgccgcaaacgccatttcgacgcgacgcccgaaccg
gatggcgcgggtgcgcggcggcgcgcgaagccgcagccgcagcccgatgggcgtgcggcc
ccacgccggccgttgcgtttcgtgatccaggagcaccatgcgcggcggctgcactacgac
ttccggctcgaactcgacggcacgctgaaatcctgggcggtgccgaagggaccgagcttc
gatccggcggtgaagcgtctggccgtgcacgtcgaggatcatccggtcgaatacgcgtcg
ttcgaagggcagattccggccggccactacggcgccggctcggtcgtcgtgtgggacgaa
ggcacgtggacgcccgacggcggcgtcgcaggcgcgcgcagcggctatcgtgcgggcaag
ctgacgttccggctcgatggcgagaagctgcacggcggctgggcgctggtgcgcagcgga
cggcaggagggacgccaggagcagtggctgctgatcaaggagcgcgacgaagcggcgcgc
agcgccgatgaattcgacgtggtcggcgagcggtcgggcagcgtgcacgacggtgagggc
ggggcatcgtcggcggcaggcggcgcgggcgcggactcgcacgatgcgacggcgcgcacg
ggtggcggcggccctagcaagcgcgccacgcagaccggcaagcgcgccgcgcgaagcggc
gagcgcgcggcacgagccgccaagcgcgccgatgaccgcgatcgcgcgaccgctcgcgca
cacgttcgcgatggcgaccgcgccgcggccagcgacggtgctgccgcacgcgaccccggc
gccgccagtatccgagctagcaccggcgacgccgaccgcacccctcgccgtactcgtact
cccggccgcgcatccgccggcgaccgcgacccctccaccgtcgaaggcgccgtgcgcgcg
ccgctgcccgagcgcatcgcgccgcaactggcgacgctggtcgacgcgccgcccgccgac
gccgactggcgctacgagctgaaattcgacggctaccggatcctcgcgcgcatcgcgggc
aagggcgcgcgtcgccacgtgaagctgatgacgcgcgaaggccgcgactggaccgcgaag
ctgcgcgcgcagcgcgaggcgctcgcggcgctgcccgtcgacgacgcctggctcgacggc
gaggccgtcgtgctcggcgcgaacggcctgcccgacttccaggcgttgcagaacgcgttc
ggcgccgggcagtcggacgacgtcacgctgttcgtcttcgacctgccgtatctcgacggt
tacgacctgcgcgatgcaccgctggccgcgcgccgcgcgctgctcgagccgctcgtcgcc
gacagcgacccgacccggctgcgcttttcccccgatctcggcgacgacgtcgcatcgctg
atcgcgagcgcctgcgacaccggcctcgaagggttgatcggcaagcgggcggaatcgcgc
tatcgcggcggacggtcggcggcctggatcaagctcaaatgtcggcgccggcaggaattc
gtgatcggcggctacaccgagccgtcgggcagccgccacggcttcggcgcgctgctgctc
ggcgtgcacgacgcgccgccggccggcaagcgctcgcgcgcggccgcgccgctgcgctac
gtcggccgcgtcggcaccggcttcgacgcgcgcgcgctcgaccggctcgcggcgctgctg
cgccggcacgagcgcgacacgacgccgttcgagccggcgccgcgcgaacgcacgcgcacg
cgcgtgcactgggtcgagccgacgctcgtcgccgaatgcgaattcgcggaatggaccggc
gacggcatcgtgcggcaggccgcgttcatcgcgttgcgcgacgacaagccggcgacgcag
atcgtccgcgaaatgccgaagcatatggaaacggagggagcgatggagcgacagcagagc
acgcccgacgcgggccatgaacgcaagcgcgcgtcgcgcgccgccgacgatacgggcaag
cgcaagccaaacgcgcgcgcgagcgcgtccgcgcgcaacgcccgtgaggatggcgacagc
gacgcggagctgtccgctcgcgtgcgcattacgcaccccgagcgcgtgctcgacccggcg
agcggcacgcgcaagatcgacctcgcacgctactggcaatgggtggcgccgtggctgctg
cccgacctgaaagggcggcccgtgtcgctcgtgcgcgcaccgggcgacatcaccggcgag
ctgttcttccagaagcacgccgagcgccgcgagattccgttcgtcacgcagcaccccggg
ctcgatcccgggcatggggcgctgctgtcgctcgacagcgtcgatgcgctgctcggcgcg
gcccagatgggcacgatcgaattgcatacgtggaacgcgcacgcatcgaacatcgagcgg
cccgatcgcatcgtgttcgacctcgatcccgatccggcgctgccgtggagcgcgatgatc
gaggccgcgcagctggtgcgagggctgctcgacgagctcggcctgcgctcgttctgcaag
acgagcggcggcaaggggctgcacgtcgtcgtgccgatcacgcggcacatgggctgggac
gacgtgaaggcgttctcgcgcgcgctcgcgcagcacgtggcgggcgcgttgcccgagcgc
ttcaccgcgacgatggggccgcggcaccggcgcggcaagatcttcatcgactacctgcgc
aacggccgcggcgcgagcacgatcgccgcctactcggtgcgcgcacggccggggctgggc
gtatcggtgccgctgcactgggacgaggtgcccgacacgacgggcggcgcgcagtggacc
atcgacacgctgcacgagcgcctcgagcgcttgaagcgcgacccgtgggaaggctacgac
gacacgcgccagcgcatcaccgcgcagatgcgcgcgcggctcgacggggcgtga

DBGET integrated database retrieval system