KEGG   Burkholderia sp. RPE64: BRPE64_ACDS07730Help
Entry
BRPE64_ACDS07730  CDS       T02684                                 

Definition
(GenBank) 2,3-dimethylmalate lyase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
buo  Burkholderia sp. RPE64
Pathway
buo00440  Phosphonate and phosphinate metabolism
buo01100  Metabolic pathways
buo01120  Microbial metabolism in diverse environments
buo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:buo00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BRPE64_ACDS07730
Enzymes [BR:buo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BRPE64_ACDS07730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL NTP_transferase IspD
Motif
Other DBs
NCBI-ProteinID: BAN22527
UniProt: R4WX62
LinkDB All DBs
Position
1:820883..822589
Genome map
AA seq 568 aa AA seqDB search
MNAPEQLPVGFSRSMRLREMLQSNRLEFLMEAHNGMSARIAKEAGFKAIWGSGLSISAQF
GVRDNNEASWTQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIE
DKQFPKTNSFINGEAQPLADMDEFCGKIKAGKDSQSDPNFSIVARVEALIAGWGMEEALK
RAEAYRQAGADAILIHSKLSKPDEILTFAREWAGRGPLVIVPTKYYSTPTDAFRQAGISC
VIWANHLIRGAVSAMQAIAKEIHDSETLVNVEDRIASVNEIFRLQDADEYSAAENIYLSA
ANEKRSAVVLAASRGAGLEALTEERPKVMLPVAGKPLLRHLVEAFKKESINDITVVGGYR
ADAIDKGGIRLVVNEQHASTGELASLACAAAHLNGDTVISYGDLLFRSYILRDLVDSDSD
FCVVVDSSQTPQAGEAGTDFAYCSTADDRALFGQKVWLESVAGAGQGIDTGRAPQGRWMG
LINVRAGARERLLATLAELQKRPDFGKLDMAALLNALIAAGEKVEVQYVHGHWRGVNDLD
DFRRAGDFAHGQSPIGSEGIDGTETARD
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaccagaacaacttcccgtcggcttttcgcgctcgatgcgcctgcgcgagatg
ctgcaaagcaaccgcctcgaattcctgatggaagcgcacaatggcatgtcggcgcgcatc
gcgaaggaagccggtttcaaggcgatctggggatcgggcctgtcgatctcggcgcagttc
ggcgtgcgcgacaacaacgaagcgagctggacgcaggtcgtcgacaacctcgaattcatg
gccgacgcgagcgatctgccgatcctgctcgacggcgacaccggctacggcaacttcaac
aacgtgcgccgtctggtgaagaagctcgagcagcgcggcatcgcgggcgtgtgcatcgag
gacaagcagtttccgaaaaccaacagcttcattaacggcgaagcgcagccgctcgccgac
atggacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgatccgaacttt
tcgatcgtggcgcgcgtcgaggcgctgatcgcgggctggggcatggaagaggcgttgaag
cgcgccgaagcgtatcgccaggcgggcgcggacgcgatcctgatccacagcaagctgtcg
aagccggacgaaatcctgacgttcgcgcgtgaatgggcggggcgcggtccgctcgtcatc
gtgccgacgaagtactacagcacgccgaccgacgccttccgtcaggcaggcatcagctgc
gtgatctgggcgaatcatctgattcgcggcgcggtgtcggcgatgcaggcgatcgccaag
gaaatccacgacagcgagacgctcgtcaacgtggaagaccgcatcgcgtcggtcaacgaa
atcttccgtctgcaggacgcggacgaatactcggcggccgaaaacatctatctgagcgcg
gccaacgagaagcgcagcgcggtcgtgctcgcggcgagccgcggcgcgggcctcgaagcg
ctgactgaagaacgcccgaaggtgatgctgccggtcgcgggcaagccgctcttgcgccat
ctcgtcgaggcgttcaagaaagaaagcatcaacgacatcaccgtggtcggcggttaccgc
gccgatgcgatcgataaaggcggcatccggctcgtcgtcaacgagcagcacgcgtcgacc
ggcgaactcgcgtcgcttgcctgcgcggcggcgcatctgaacggcgataccgtcatctcc
tacggcgacctgctgttccgcagctacatcctgcgcgatctggtggattccgacagcgac
ttctgcgtggtcgtcgattcgtcgcagacgccgcaggcgggcgaagcgggcaccgacttc
gcctactgctcgaccgccgacgaccgcgcgctgttcggccagaaagtgtggctggaaagc
gtggccggcgcggggcagggtatcgacacgggccgcgcgccgcagggccgctggatgggc
ctcatcaacgtgcgcgcgggtgcgcgtgagcggctgctcgcaacccttgcggaactgcag
aagcgcccggacttcggcaagctcgacatggccgcgctgctgaacgcgcttatcgccgcc
ggcgagaaggtcgaagtgcaatacgtgcacggccactggcgcggcgtgaacgatctcgac
gacttccgtcgcgcgggcgatttcgcgcacggccagtcgccgatcggttccgaaggcatc
gacggcacggagaccgcgcgtgattga

DBGET integrated database retrieval system