KEGG   Burkholderia sp. RPE64: BRPE64_ACDS15530Help
Entry
BRPE64_ACDS15530  CDS       T02684                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
buo  Burkholderia sp. RPE64
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:buo00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BRPE64_ACDS15530
Enzymes [BR:buo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BRPE64_ACDS15530
DNA repair and recombination proteins [BR:buo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BRPE64_ACDS15530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(1605624..1608353)
Genome map
AA seq 909 aa AA seqDB search
MAAKLETYQRMRSFDKTPEPSGTAKRGTRTKKAAPQGLSFVIQEHDARRLHYDFRLELDG
TLKSWAVPKGPSLDPSVKRLAVHVEDHPLDYGSFEGEIPEGNYGAGSVIVWDRGTWAPQS
GSFEDAAREYEKGKLKFTLDGEKLHGGWTLVKSHMRGSGDKEQWLLIKERDDDARPEAEY
DILLKKPGSVLSESLGARSKSGAVRERTERRASAKKTTARKSAAKTTKTNGHAHPDIVAT
RSAESLRTLSHEPAIEGALKAKLPASLKPQLATLVDAAPPGDDWAYEIKFDGYRVLARIE
TVKGKRVIRMDTRNGNDWTAKFSKQVKALEQLDIESGWLDGEAVVLDERGLPDFQALQNA
FDVGRPQDIVVYFFDVPYLNGYDLRHVPLVQRRAILKALIEPIDDPVLRYSQDFAFHADD
LLKSACDMALEGIIGKRMDATYVSGRSNSWIKLKCRRRQEFVIGGYSEPSGSRGQFGALL
LGVYDTHGKLQYAGRVGSGFDHATLVAVKKELDRRESKRMPFASEPQERSRTPVHWVKPE
LVAECNFAEWTKERIVRQASFVSLRDDKPARQIVKEEPAAAKKVAKKAATKTATKTAAKK
SVAAKTKSASTEVDGVKISHPERVIDKSTGLRKIDVVEYYASVADWILPHLKDRPVSLVR
APEDIGGELFFQKHSAKLAIPHITQHPDIDPGHPPLLTIESAGALVGTAQMGTVELHTWN
AVASNIEKPDRMVFDLDPGEGVGWARMIEAARLTRELLVELGLESFCKTSGGKGFHVVVP
LVKQAGWDEMKDFSQAVAQHMASTLPKLFSAKMGMQNRKGKIFIDYLRNNRGSSTVAAFS
LRARPGLGASMPIAWEELDDVQSGDQWNIGNVRERLDALKDDPWAGYERARKRLTADMKK
RLGLNNPRK
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaagctcgaaacctatcagcgcatgcgcagcttcgacaagacgccggagccg
tccggtactgcgaagcggggcacgcgcacgaagaaggccgccccgcaagggctttcgttc
gtgattcaggaacacgatgcgcgccgcctgcactacgacttccggctggaactcgacggc
acgctcaaatcgtgggccgtgccgaaggggccgagcctcgatccgtcggtgaagcggctt
gccgtgcatgtcgaggatcatccgctcgattacggctcgttcgaaggcgagattcccgag
ggcaactatggcgcgggcagcgtcatcgtgtgggatcgcgggacgtgggcgccgcaatcg
ggcagcttcgaggacgccgcgcgcgagtacgagaaaggcaagctcaagttcacgctcgac
ggcgaaaagctgcacggcggctggacgctcgtgaaaagccatatgcgcggcagcggcgac
aaggagcaatggctgctcatcaaggagcgcgacgacgacgcgcggcccgaagccgagtac
gacatcctgttgaagaagccgggcagcgtgctgtcggagtcgcttggcgcgcgctccaag
agcggcgcagtgcgcgagcgtacggagcgccgggcgagtgcgaagaaaactacagcacgc
aagtcagcggcaaagaccacgaagacgaacggccacgcgcatccggatatcgtcgcgacg
cgcagcgcggaatcgctgcgcacgctgtcgcatgaacccgcgatcgaaggcgcgctcaag
gcgaagcttcccgcgagcctcaagccgcagcttgcgacgctcgtcgatgccgcgccgccc
ggcgacgactgggcctatgaaatcaagttcgacggttatcgcgtgctggcccgcatcgag
acggtgaagggcaaacgcgtgatccgcatggacacgcgcaacggcaacgactggaccgcg
aagttctcgaagcaggtgaaggcgcttgaacaactcgacatcgaaagcggctggctcgac
ggcgaagccgtggtgctagacgaacgcggcctgcccgattttcaggcgctgcaaaacgcc
ttcgatgtggggcggccgcaggacatcgtcgtgtatttcttcgatgtgccttatctcaac
ggctacgacctgcgccacgtgccgctcgtgcagcgtcgcgcgattctgaaggcgctgatc
gaaccgatcgacgatccggtactgcgctattcgcaggacttcgcctttcacgccgacgac
ctgctgaaaagcgcatgcgacatggcgctcgaaggcatcatcggcaagcgcatggatgcc
acgtatgtgtcggggcgcagcaattcgtggatcaagctcaagtgtcgtcgccggcaggag
ttcgtgatcggtggctattcggagccgtcgggcagccgtggtcagttcggcgcgctgctg
ctcggcgtctacgacacgcacggcaagctgcaatacgcggggcgcgtcggcagcggcttc
gatcacgcgacgcttgtcgcggtgaagaaggaactcgaccgccgcgaaagcaagcgcatg
ccgtttgcgagcgagcctcaggaacgcagccggacacccgtgcattgggtgaagccggaa
ctcgtggccgaatgcaattttgcggaatggaccaaggagcgcatcgtgcgacaagcatcg
ttcgtcagtctgcgcgacgacaaaccggcgcggcagatcgtgaaggaagagcccgccgcg
gcgaagaaggtggccaagaaagcggccactaagaccgccacgaaaacagcggcgaagaag
agcgtcgccgcaaaaaccaagtcggcttcgaccgaagtcgatggcgtgaagatcagtcat
ccggaacgggtcatcgacaagtccaccgggctgcgcaagatcgatgtcgtcgagtattac
gcatcggtcgccgactggatcttgccgcatctgaaggaccggccggtgtcgctcgtgcgc
gcgcctgaggacatcggcggcgagcttttttttcagaagcacagcgcgaagctcgcgatt
ccgcatatcacgcagcatcccgatatcgatccgggccatccaccgctgcttaccatcgag
tcggccggcgcgctcgtcggcacggcgcaaatgggcaccgtcgaactgcatacgtggaat
gcggttgcgtcgaacatcgaaaagccggatcgcatggtgttcgatctcgatccgggtgag
ggcgtgggctgggcgcgcatgatcgaggccgcgcggcttacgcgagaactgctcgtcgaa
ctgggtctcgaatcgttctgcaagacgagcggcggcaagggctttcacgtggtcgtgccg
ctcgtgaagcaagcgggctgggacgagatgaaggacttttcgcaggccgtcgcgcaacac
atggcgagcaccttgcccaagctcttttccgcgaagatgggcatgcagaatcgcaagggg
aagattttcatcgactatctgcgcaacaaccgcggctcaagcacggtcgcagcgttttcg
ttgcgggcgcgtccgggactcggcgcatccatgccgatcgcctgggaagaactcgacgat
gtgcagagcggcgatcaatggaacatcggcaacgtgcgcgaacggcttgatgcgttgaag
gacgatccgtgggccggctatgaacgcgcgcgcaagcggctcacggccgacatgaagaag
cggctcgggctgaacaacccgcgcaaatga

DBGET integrated database retrieval system