KEGG   Burkholderia lata: Bcep18194_A3432Help
Entry
Bcep18194_A3432   CDS       T00286                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
bur  Burkholderia lata
Brite
Translation factors [BR:bur03012]
 Eukaryotic Type
  Elongation factors
   Bcep18194_A3432
 Prokaryotic Type
   Bcep18194_A3432
Mitochondrial biogenesis [BR:bur03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Bcep18194_A3432
Exosome [BR:bur04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Bcep18194_A3432
  Exosomal proteins of breast cancer cells
   Bcep18194_A3432
  Exosomal proteins of colorectal cancer cells
   Bcep18194_A3432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:301228..302418
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTKKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIVKGSAKLALE
GDTGELGEVAIMSLADALDTYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
ITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaagggtaaattcgagcggaccaagccgcacgtgaacgttggtacgattggtcac
gttgaccacggcaagacgacgctgacggcagcgatcacgacggttctgacgaagaagttc
ggcggcgaagcgaaggcatacgaccagatcgacgcggcaccggaagaaaaggcgcgcggc
atcacgatcaacacggcgcacgtcgagtacgaaacggctaaccgccactacgcacacgtc
gactgcccgggccacgctgactatgtgaagaacatgatcacgggcgcagcgcagatggac
ggcgcgatcctggtttgctcggcagctgacggcccgatgccgcagacgcgtgagcacatc
ctgctggcgcgtcaggttggcgttccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgctgaactgctcgagctggtcgagatggaagttcgcgaactcctgtcgaag
tacgacttcccgggcgacgacacgccgatcgtgaagggttcggccaagctggcgctggaa
ggcgacacgggcgagctgggcgaagtggcgatcatgagcctggccgacgcgctggacacg
tacatcccgacgccggagcgtgcagttgacggcgcgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgtggtacggtcgtgacgggtcgcgttgagcgcggcatcgtgaag
gtcggcgaagaaatcgaaatcgtcggtatcaagccgacggtgaagacgacctgcacgggc
gttgaaatgttccgcaagctgctggaccaaggtcaagcaggcgacaacgttggtatcctg
ctgcgcggcacgaagcgtgaagacgtggagcgtggccaggttctggcgaagccgggttcg
atcacgccgcacacgcacttcacggctgaagtgtacgtgctgagcaaggacgaaggcggc
cgccacacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgagctgccgaaggacaaggaaatggtgatgccgggcgacaacgtgtcg
atcacggtgaagctgattgcaccgatcgcgatggaagaaggtctgcgcttcgcaatccgc
gaaggcggccgtacggtcggcgccggcgtcgtcgccaagatcatcgagtaa

DBGET integrated database retrieval system