KEGG   Burkholderia vietnamiensis LMG 10929: AK36_5227Help
Entry
AK36_5227         CDS       T03893                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bve  Burkholderia vietnamiensis LMG 10929
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bve00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    AK36_5227 (ligD)
Enzymes [BR:bve01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AK36_5227 (ligD)
DNA repair and recombination proteins [BR:bve03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AK36_5227 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
III:268193..271180
Genome map
AA seq 995 aa AA seqDB search
MAGKLDPYRRKRHFDATPEPAGAGARRRAKPQPQPDGRAAPRRPLRFVIQEHHARRLHYD
FRLELDGTLKSWAVPKGPSFDPSVKRLAVHVEDHPVEYASFEGQIPAGHYGAGSVVVWDE
GTWTPDGGVAGARSGYRAGKLTFRLDGEKLHGGWALVRSGRQEGRQEQWLLIKERDEAAR
SADEFDVVGERPGSVHDGEGGASSATGGAGADSHDATARAGGGGKRATQTGKRAARSGER
AARAAERADDRDRATARAHVRDGDRAAARDGAAASDPGAARVRARTGAGDADRTPRRTRT
PDRASAGDRDPSTVEGAVRAPLPERIAPQLATLVDAPPADADWRYELKFDGYRILARIAG
KGARRHVKLMTREGRDWTAKLRAQRDALAALPVDDAWLDGEAVVLGANGLPDFQALQNAF
GAGQSDDVTLFVFDLPYLDGYDLRDAPLAARRALLEPLVADSDPTRLRFSPDLGDDVASL
IASACDTGLEGLIGKRAESRYRGGRSAAWIKLKCRRRQEFVIGGYTEPSGSRHGFGALLL
GVHDAPPAGKRSRAAAPLRYVGRVGTGFDARALDRLAALLRRHERDTTPFEPAPRERTRT
RAHWVEPTLVAECEFAEWTGDGIVRQAAFIALRDDKPATQIVREMPKHMETEGAMERQQS
TPDAGHERKRASRAADDTGKRKPNARASASARNAREDGDAELSGRVRITHPERVLDPTSG
TRKIDLARYWQWVAPWLLPDLKGRPVSLVRAPGDITGELFFQKHAERREIPFVTQHPGLD
PGHGALLSLDSVDALLGAAQMGTIELHTWNAHASNIERPDRIVFDLDPDPALPWSAMIEA
AQLVRGLLDELGLRSFCKTSGGKGLHVVVPITRHMGWDDVKAFSRALAQHVAGALPERFT
ATMGPRHRRGKIFIDYLRNGRGASTIAAYSVRARPGLGVSVPLHWDEVPDTTGGAQWTID
TLHERLERLKRDPWEGYDDTRQRITAQMRARLDGA
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaagctcgatccgtatcgccgcaaacgccatttcgacgcgacgcccgaaccc
gccggcgcgggcgcgcggcggcgcgcgaagccgcagccgcagcccgatgggcgtgcggcc
ccgcgccggccgttgcgcttcgtgatccaggaacatcatgcgcggcggctgcactacgac
ttccggctcgaactcgacggcacgctgaagtcatgggcggtgccgaaggggccgagcttc
gatccgtcggtgaagcgtctggccgtgcacgtcgaggatcatccggtcgaatacgcgtcg
ttcgaagggcagattccggccggccactacggcgccgggtcggtcgtcgtgtgggacgaa
ggcacgtggacgcccgacggcggcgtcgcgggcgcgcgcagcggctatcgcgcgggcaag
ctgacgttccggctcgatggcgagaagctgcacggcggctgggcgctggtgcgcagcggg
cggcaggagggacgccaggagcagtggctgctgatcaaggagcgcgacgaagcggcgcgc
agcgccgatgaattcgacgtggtcggcgagcggccgggcagcgtgcacgacggtgagggc
ggggcgtcgtcggcgacaggcggcgcgggcgcggactcgcacgatgcgacggcgcgcgcg
gggggcggcggcaagcgcgccacgcagaccggcaagcgcgccgcgcgaagcggcgagcgc
gcggcacgagccgccgagcgcgccgatgaccgcgatcgcgccaccgcccgcgcgcacgtt
cgcgatggcgaccgcgccgcggcccgcgacggtgctgccgcaagcgaccccggcgccgcc
cgcgtccgagctcgcaccggcgccggcgacgccgaccgcacccctcgccgtacgcgtact
cccgaccgcgcatccgccggcgaccgcgatccctccaccgtcgaaggcgcggtgcgcgcg
ccgctgcccgagcgcatcgcgccgcaactggcgacgctggtcgacgcgccgcccgccgac
gcagactggcgctacgagctgaaattcgacggctaccggatcctcgcgcgcatcgccggc
aagggcgcgcgtcgccacgtgaagctgatgacgcgcgaaggccgcgactggaccgcgaag
ctgcgcgcgcagcgcgatgcgctcgcggcgctgcccgtcgacgacgcgtggctcgacggc
gaggccgtcgtgctcggcgcgaacggcctgcccgacttccaggcgttgcagaacgcgttc
ggcgccgggcagtcggacgacgtcacgctgttcgtcttcgacctgccgtatctcgacggt
tacgacctgcgcgatgcgccgctggccgcgcgccgcgcgctgctcgagccgctcgtcgcc
gacagcgacccgacccggctgcgcttttcccccgatctcggcgacgacgtcgcatcgctg
atcgcgagcgcctgcgacaccggcctcgaagggctgatcggcaagcgggcggaatcgcgc
tatcgcggcggacggtcggcggcctggatcaagctcaaatgccggcgccggcaggaattc
gtgatcggcggctacaccgagccgtcgggcagccgccacggcttcggcgcgctgctgctc
ggcgtgcacgacgcgccgccggccggcaagcgctcgcgcgcggccgcgccgctgcgctac
gtcggccgcgtcggcaccggcttcgacgcgcgcgcgctcgaccggctcgccgcgctgctg
cgccggcacgagcgcgacacgacgccgttcgagccggcgccgcgcgaacgcacgcgcacg
cgcgcgcactgggttgagccgacgctcgtcgccgaatgcgaattcgcggaatggaccggc
gacggcatcgtgcggcaggccgcgttcatcgcgttgcgcgacgacaagccggcgacgcag
atcgtccgagaaatgccgaagcatatggaaacggagggagcgatggagcgacagcagagc
acgcccgacgcgggccatgaacgcaagcgcgcgtcgcgcgccgccgacgatacgggcaag
cgcaagccaaacgcgcgcgcgagcgcgtccgcgcgcaacgcacgtgaggacggcgacgcg
gagctgtccggccgcgtgcgcatcacgcatcccgagcgcgtgctggacccgacgagcggc
acgcgcaagatcgatctcgcacgctactggcaatgggtggcgccgtggctgctgcccgac
ctgaaagggcggcccgtgtcgctcgtgcgcgcaccgggcgacatcaccggcgagctgttc
ttccagaagcacgccgagcgccgcgagattccgttcgtcacgcagcaccccgggctcgat
cccgggcatggggcgctgctgtcgctcgacagcgtcgatgcgctgctcggcgcggcccag
atgggcacgatcgaattgcatacgtggaacgcgcatgcatcgaacatcgagcggcccgat
cgcatcgtgttcgacctcgatcccgatccggcgctgccgtggagcgcgatgatcgaggcc
gcgcagctggtgcgcgggctgctcgacgagctcggcctgcgctcgttctgcaagacgagc
ggcggcaaggggctgcacgtcgtcgtgccgatcacgcggcacatgggctgggacgacgtg
aaggcgttctcgcgcgcgctcgcgcagcacgtcgcgggcgcgctgcccgagcgcttcacc
gcgacgatggggccgcggcaccggcgcggcaagatcttcatcgactacctgcgcaacggt
cgcggcgcgagcacgatcgccgcctactcggtgcgcgcacggccggggctgggcgtatcg
gtgccgctgcactgggacgaggtgcccgacacgacgggcggcgcgcagtggaccatcgac
acgctgcacgagcgcctcgagcgcttgaagcgcgacccgtgggaaggctacgacgacacg
cgccagcgcattaccgcgcagatgcgcgcgcggctcgacggggcgtga

DBGET integrated database retrieval system