KEGG   Burkholderia vietnamiensis G4: Bcep1808_2510Help
Entry
Bcep1808_2510     CDS       T00493                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcep1808_2510
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Bcep1808_2510
   00680 Methane metabolism
    Bcep1808_2510
Enzymes [BR:bvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Bcep1808_2510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1:2779672..2782665
Genome map
AA seq 997 aa AA seqDB search
MKSSGSARTARRNAALPSTDAQTGALATVANGRAKPATKPKDSIRQTKRTTKAAGASKPA
ARTREDKDGPLFEDIRFLGRLLGDVVREQEGDTVFDVVETIRQTAVKFRREDDSQAAQTL
EKKLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQPGTVAYALEQL
KTSGNASKRVLQRFFDDALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQPLTARERA
YNESMLRARVTALWQTRMLRDARLTVGDEIENALSYYRTTFLDELPALYGDIEAALAEHG
LPARVPAFFQMGSWIGGDRDGNPNVTAATLDEAINRQAAVILEHYLEQVHKLGAELSVSN
LLVGANDAVKALAAASPDQSPHRVDEPYRRALIGIYTRLAASARVRLGEGTVPVRSAGRG
APPVRAVPYADSEAFVADLKVLTASLEEHHGASLAAPRLTPLMRAAEVFGFHLSSIDLRQ
SSDIHEAVVAELFARAGVHADYASLSEDDKLIALLAALADPRPLRSPYIEYSALAQSELG
VFEKAREVRAQFGPRAVRNYIISHTETVSDLVEVLLLQKETGLLEGAFGAAHDSARNGLM
VIPLFETIPDLRDAARIMREYFALPGIEALIAHQGAEQEVMLGYSDSNKDGGFLTSNWEL
YRAELALVDLFRDRKITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEVI
ASKFANPEIGRRNLETVVAATLEASLLPQSNAPAQLPAFEAAMQALSDAAMASYRALVYE
TPGFTDYFFAATPITEIAELNIGSRPASRKLQDPKNRRIEDLRAIPWGFSWGQCRLLLTG
WYGFGSAVSAYLDGAPDAAARTKRVALLKKMNKTWPFFANLLSNMDMVLAKTDLAVASRY
AQLVADRKLRKHVFERIVAEWERTAQALAEITGHEGRLATNPLLARSIKNRFPYLDPLNH
LQVELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgtacggcgcgccgcaatgctgccctgccctccaccgac
gcccagacgggcgccctcgccaccgtcgcgaacggccgtgcgaaaccggcaacgaaaccg
aaagactcgatacgtcagacaaaacgcacgacgaaggcggccggcgcgtcgaagcccgcc
gcgcgcacgcgcgaggacaaggacggcccgctgttcgaggacatccgcttcctcggccgc
ctgctcggcgacgtcgtgcgagaacaggaaggcgacaccgtgttcgacgtcgtcgaaacg
attcgtcagaccgcggtgaagtttcgccgcgaggacgacagccaagccgcgcagacgctc
gagaagaagctgcgcaagctgacgccggagcagacggtgagcgtggtgcgcgcgttcagc
tacttctcgcatctcgcgaacatcgcggaagaccgccatcacaaccgccgccgccgcatt
cacgcgctcgcgggctccgcgccgcaaccgggcaccgtcgcgtacgcgctcgaacagctg
aagacgagcggcaacgcatcgaagcgcgtgctgcagcgcttcttcgacgatgcgctgatc
gtgccggtgctgactgcgcacccgaccgaggtgcagcgcaagagcatcctcgacgcgcag
cacgacatcgcgcgcctgctcgccgaacgcgaccagccgctgaccgcgcgcgaacgcgcc
tacaacgaatcgatgctgcgcgcgcgcgtgaccgcgctgtggcagacgcgcatgctgcgc
gacgcgcgcctgacggtcggcgacgagatcgagaacgcgctgtcgtactaccgcaccacc
ttcctcgacgaactgcccgcgctgtacggcgacatcgaagccgcgctcgccgagcacggc
ctgcccgcgcgcgtgcccgcgttcttccagatgggcagctggatcggcggcgatcgcgac
ggcaacccgaacgtgacggccgcgacgctcgacgaagcgatcaaccgccaggccgcggtg
atcctcgaacactatctggaacaggtgcacaagctcggcgccgaactgtcggtgtcgaac
ctgctggtgggcgcgaacgacgcggtgaaggcgctcgccgccgcgtcgccggaccagtcg
ccgcaccgcgtagacgaaccctaccgccgcgcgctgatcggcatctacacgcggctcgcg
gcgagcgcgcgcgtgcgcctcggcgagggcaccgtgccggtgcgcagcgcgggccgcggc
gcgccgccggtgcgcgcggtgccgtacgccgattccgaagcgttcgtcgccgacctgaag
gtgctgaccgcgtcgctcgaagaacatcacggcgcgtcgctcgccgcgccgcgcctcacg
ccgctgatgcgcgcagccgaagtgttcggcttccacctctcgagcatcgacctgcgccag
agctccgacatccacgaagccgtggtcgccgagctgttcgcgcgcgcgggcgtgcatgcc
gactacgcgtcgctgtccgaggacgacaagctgatcgcgttgctggccgcgctcgccgat
ccgcgcccgctgcgctcgccgtacatcgaatactcggcgctcgcgcaaagcgagctgggc
gtgttcgagaaggcgcgcgaggtacgcgcgcagttcgggccgcgcgcggtgcgcaactac
atcatctcgcacacggagacggtcagcgacctcgtcgaggtgctgctgctgcagaaggaa
acgggcctgctcgaaggtgcgttcggcgcggcgcacgacagcgcgcgcaacggcctgatg
gtgatcccgctgttcgagaccattcccgacctgcgcgacgccgcgcgcatcatgcgcgaa
tacttcgcgctgccgggcatcgaggcgctgatcgcgcatcagggcgccgagcaggaagtg
atgctcggctattcggacagcaacaaggacggcggcttcctgacgtcgaactgggagctg
tatcgcgcggagctcgcgctcgtcgacctgttccgcgaccgcaagatcacgctgcgcctg
ttccacggccgcggcggcacggtcggccgcggcggcggcccgacctatcaggcgatcctg
tcgcagccgccgggcaccgtgaacggccagatccgcctcaccgaacagggcgaggtgatc
gcgagcaagttcgcgaacccggagatcggccggcgcaacctcgaaaccgtggtggccgcg
acgctcgaggcgtcgctgctgccgcagtcgaacgcgcccgcgcaactgcccgcgttcgaa
gccgcgatgcaggcgctgtccgacgcggcgatggcgtcgtatcgcgcgctcgtctacgaa
acgcccggcttcaccgactacttcttcgcggccacgccgatcaccgagatcgccgagctg
aacatcggcagccgcccggcgtcgcgcaagctgcaggacccgaagaaccgccggatcgag
gatctgcgcgcgattccgtggggcttctcgtggggccagtgccgcttgctgctgaccggc
tggtacggcttcggcagcgcggtgagcgcgtatctcgacggcgcgccggacgcggccgcg
cgcacgaagcgcgtcgcgctgctgaagaagatgaacaagacctggccgttcttcgcgaac
ctgctgtcgaacatggacatggtgctcgcgaagaccgatctcgcggtcgcgtcgcgctac
gcgcagttggtcgccgaccgcaagctgcgcaagcacgtgttcgagcggatcgtcgccgaa
tgggagcgcaccgcgcaggcgctcgcggagatcaccgggcacgaagggcgcctcgcgacc
aacccgctgctcgcgcgctcgatcaagaaccgcttcccgtatctcgatccgctgaaccac
ctgcaggtcgagctgatcaagcgtcaccgcgcgggcgacacgaacgcgcgtctgcgccgc
gggattcatctgacgatcaacgggatcgcggccgggctgcgcaacacgggctga

DBGET integrated database retrieval system