KEGG   Burkholderia vietnamiensis G4: Bcep1808_3589Help
Entry
Bcep1808_3589     CDS       T00493                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase apoenzyme
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bcep1808_3589
   00650 Butanoate metabolism
    Bcep1808_3589
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bcep1808_3589
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bcep1808_3589
Enzymes [BR:bvi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Bcep1808_3589
Amino acid related enzymes [BR:bvi01007]
 Aminotransferase (transaminase)
  Class III
   Bcep1808_3589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2:328540..329823
Genome map
AA seq 427 aa AA seqDB search
MKNADLHARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRHPK
IVKAIADQLNCFTHTAYQIVPYASYVELAEKINARAPGDYPKKTAFFTTGAEAVENAIKI
ARAATGRPGVIAFAGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNPLHGVTTA
DSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPADFVRALRKICNEHGIMLIADEV
QTGFARTGKLFAMQQYDVLADLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVASAHAVLDIIDEEKLCERATQLGDALKAKLNALRADIAPIADVRGPGAMVAVEFVN
PATGEPDADFTKRVQARALERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALTILEEVLK
ETVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgccgacctgcatgcccgcaagaacgccgccaccccgcgcggcgtcggcgtg
atgtgcgatttctacgccgcccgcgccgaaaacgcggagctgtgggacgtcgagggccgc
cgcttcatcgatttcgccgccggcatcgccgtgctgaacacgggccaccgccacccgaag
atcgtcaaggcgatcgccgaccagctgaactgcttcacgcacaccgcttaccagatcgtc
ccgtacgcgtcgtacgtcgagctggctgaaaagatcaacgcgcgcgcaccgggcgactac
ccgaaaaagacggcgttcttcacgaccggcgccgaagccgtcgaaaacgcgatcaagatc
gcgcgtgcggcaaccggccgtccgggcgtcatcgcgttcgccggtggtttccacggccgc
acgatgatgggcatggcgctgaccggcaaggtcgcaccgtacaagctgaacttcggtccg
ttcccgggcgacgtgttccacgcaccgtacccgaacccgctgcacggcgtgacgacggcc
gactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgcgtcgcc
gcgatcatcttcgaaccggtccagggcgaaggcggcttcaacccggcgccggccgacttc
gtgcgcgcactgcgcaagatctgtaacgagcacggcatcatgctgatcgccgacgaagtg
cagacgggcttcgcgcgtaccggcaagctgttcgcgatgcagcagtacgacgtgctggcc
gacctgatcacgatggccaagagcctcgcgggcggcatgccgctgtcgggcgtcgtcggc
cgtgcggacgtgatggacgcggcagcgcccggcggcctcggcggcacgtacgccggcaac
ccgctcgccgtcgcgtcggcgcacgcggtgctcgacatcatcgacgaagagaagctgtgc
gaacgcgcgacgcaactgggcgacgcgctgaaggcgaagctgaacgcgctgcgcgccgac
atcgcaccgatcgccgacgtgcgcggtccgggcgcgatggtcgcggtcgagttcgtgaac
ccggccacgggcgagcccgacgccgacttcacgaagcgcgtgcaggcgcgtgcgctcgag
cgcggtctgctgctgctcgtgtgcggcgtgtactcgaacgtcgtgcgcttcctgttcccg
ctgacgattccgcaggccgtgttcgacgaagcgctcacgatcctcgaggaagtgctgaag
gaaacggtcggcgtaccggcctga

DBGET integrated database retrieval system