KEGG   Brucella vulpis: BF3285c2_0450Help
Entry
BF3285c2_0450     CDS       T04257                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bvl  Brucella vulpis
Pathway
bvl00473  D-Alanine metabolism
bvl01100  Metabolic pathways
bvl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bvl00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BF3285c2_0450 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BF3285c2_0450 (alr)
Enzymes [BR:bvl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BF3285c2_0450 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bvl01011]
 Precursor biosynthesis
  Racemase
   BF3285c2_0450 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CUW45330
UniProt: A0A0U5IFY3
LinkDB All DBs
Position
2:462058..463257
Genome map
AA seq 399 aa AA seqDB search
MVEMSLPFSQDERDLAAGGILTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRV
APAFYEAGCRDFFVAHLGEAVALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLE
QVENWAALATRLGKKLPALLQFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLAN
GDEPGNAANAHQLAKMTALLARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPER
QHDFSDKVAHENKEPKHSILPVLTLSARVIQVRDVDKGATVGYGGTYVAKGPMRIATIAV
GYADGLFRSLSNKGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQR
LEDVARDCDTIPYEILTALGNRYARVYVYVNGGGTSTTA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggttgagatgtctttacctttttctcaggatgagcgcgatctcgcggctggcggcata
ttgaccattgatctcgcagccctgcgccacaattattcagccattgcaacccgcattgca
ccaacccgtacggccgctgtggtgaaggcagacgcctatggcctgggcgcaagccgggtc
gcaccggctttctatgaggccggttgccgcgatttcttcgttgcacatcttggcgaagca
gtagcgctaaagccctttttgaaacccgacgcaacactttatgtcctgaacggcctgcag
cccggaacggaagcagcctgtgcccgcgaaggcatcctgcctgttctcaattcgctggaa
caggttgaaaactgggcagcactcgccacccggctgggcaaaaaactgcccgccctgctc
cagttcgataccggcatgtctcgtcttggcctgtcagccaaggaatttgaccgccttctg
gagaacgtcacgctcctgagcaggatcgacatcaaattcgccatcagccatctggcaaac
ggcgacgagccgggaaatgcggcaaatgcccatcagcttgccaagatgacggccttgctc
gctcgcctgccgaaactgccggctgccttggccaattccggcggcaccttcctcggcaag
acctattatttcgatctcgcccgccccggcatcgcactttatggcatcgatccggagagg
cagcatgacttttcggataaggtggcgcacgagaataaggaacccaagcattcgatcctt
cccgtcctcaccctttcggcgcgtgtcattcaggtgcgcgacgtcgacaagggagcgaca
gttggctatggcggcacctatgtcgccaaaggcccgatgcggattgcgactattgcggtc
ggctatgccgatggcttgttccgttccttgagtaacaagggcgcagcctttttcggcgat
acgcgcctgcccatcatcgggcgcgtatcgatggattcgatcacgctcgacgtcacctca
ttgccggagggaacgctgaaactcggcagccttgtggaattaatcggcccgcatcagcgc
ctcgaagacgtggcgcgggactgcgacactatcccctatgaaattctgactgcgcttggc
aaccgttatgcgcgcgtttacgtttacgtgaatggcggtggcaccagcacaacagcataa

DBGET integrated database retrieval system