KEGG   Bosea vaviloviae: BHK69_13460Help
Entry
BHK69_13460       CDS       T04483                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bvv  Bosea vaviloviae
Pathway
bvv03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bvv00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BHK69_13460
Enzymes [BR:bvv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BHK69_13460
DNA repair and recombination proteins [BR:bvv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BHK69_13460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AOO81338
UniProt: A0A1D7U1T7
LinkDB All DBs
Position
2926338..2928977
Genome map
AA seq 879 aa AA seqDB search
MAGKLQAYRAKRDFEKTREPGDDAPVASSDRLRFVIQKHDATRLHYDLRLELDGVFKSWA
VTKGPSLDPHDKRLAVEVEDHPLAYGDFEGTIPKGEYGGGTVQLWDRGFWKPEGKLSAHR
QFEKGDLKFTLEGDRLHGSFVLVRMRNDRDGGKRTNWLLIKHRDEHAIDGNGEAVLKTDT
SVASGRTMAAIAAGKGRSPKPFLLAESVLAPDAEWDSRKRLAAKRLAAKPRRGEATSPRK
REARAAEMPSFIAPQLSRSVERPANGDDWVHEIKFDGYRIQMRIEAGKVTLKTRKGLDWT
AKFRAIAKAAEGFPNAIIDGEIVAFDSRGSPDFAALQAAISEGKTQDLVFFAFDMLFDAE
IDLRKQTLRERKEQLKAYLDAHADGVVLRYVEHFETGGDAVLRSACKLSLEGIVSKAVDA
PYVSGRSDTWTKAKCRAGHEVVIGGWSTTAGRFRSLLVGVNRGSHFVYIGRVGTGYSASK
VERLLPRLKAVAAKTSPFTGAGAPKREPGVTWLKPELVAEIEFAGWTGDGMVRQAAFKGL
REDKPAEEVETELPADPEETATPEPRPARSRDRGGKVDVMGVGISHPDKALWPNAGDDRP
VSKQDLAEYFAAVGEWMLPHIKGRPCSLVRAPDGIDGEMFFQRHAGMGTSNLFELVRVFG
DKKPYLQIDRIEALAAAAQIGGIELHPWNCAPGDPEVPGRLVFDLDPGPGVSFGDVIDAA
KQMRERLEALGLTSFCKTTGGKGLHVVAPLAPGKRSKVDWPAAKDFARRVCADLASEEPS
RYVVNMAKRLRNGRIFLDYLRNDRMATAVAPLSPRARPGAHASMPLTWSQVKSGLDPSRF
TVRTLPGLLKKTGAWEGYDDAAGSIADAIKKLGKRAEAA
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
ttggcgggcaagctgcaggcatatcgcgccaagcgcgattttgagaagaccagggagccc
ggcgatgacgccccggtggcctcgtcggatcgcttgcgcttcgtcattcaaaaacatgac
gccaccaggctgcactatgacctgcgtctcgagctcgatggcgtcttcaaatcctgggcg
gtgacgaagggtccatcgctcgatcctcacgacaagcgccttgctgtcgaagtcgaagat
caccctctcgcctatggcgacttcgagggaacgatccccaagggcgaatatggcgggggc
accgtccagctctgggatcgtggcttctggaaacctgaggggaaactcagtgcccacagg
caattcgagaaaggcgacctgaaattcacgctcgaaggcgacaggctccacggcagcttc
gtcctcgtccgaatgcgaaacgatcgggacggcggcaagcggaccaattggctcctcatc
aagcatcgcgacgagcatgcgattgatggcaatggcgaagcggttctgaaaaccgacact
tcggtggcatctggccggacgatggctgcgatagcggcgggtaaaggacgctctcccaag
ccctttttgctcgccgaaagcgttctggctccggatgcggaatgggacagccggaaaagg
ctcgcggccaaaagactcgcagctaagccgaggcgcggtgaggcgacatcgcctcgcaaa
cgcgaagcgcgcgccgccgagatgccgtccttcatcgcgccgcaactctccagaagcgtc
gagcgcccagccaatggagacgactgggtccacgagatcaaattcgacggttaccgcatc
cagatgcggatcgaagccggcaaggtcacgctgaagacgcgcaaaggcctcgactggacc
gcgaagttccgcgcgatcgcgaaggccgccgaggggtttccgaacgccatcatcgatggc
gagatcgtcgcatttgatagccggggctcacctgattttgcggcgcttcaagccgcgatt
tccgaaggcaagacgcaggatctcgtctttttcgctttcgacatgctcttcgacgccgag
atcgatctgcgcaagcagacgctccgggagcgaaaagagcagctgaaggcctatctcgac
gcacacgccgacggtgtcgttcttcgctatgtcgagcatttcgagaccggcggcgatgcc
gtgctgaggtcggcctgtaaattgtcgctggagggcatcgtctcgaaggccgtcgatgcg
ccctatgtctcgggccgcagcgacacctggaccaaggccaaatgtcgcgccgggcacgag
gtcgtcatcggcggctggtcgaccacggccggcaggttcagatcattgctcgtcggcgtc
aatcgcggctcccatttcgtctatatcggccgggtcggcaccggctacagcgcctccaag
gtcgaacgattgctgccgcgattgaaggcggtcgccgcgaagacgtcacccttcacgggc
gccggagcgccgaaacgcgagcctggcgtgacctggctgaagcccgagctcgtcgccgag
atcgagttcgccggctggaccggcgacggcatggtgcgacaggcggccttcaagggactg
cgcgaggacaagcccgccgaagaggtcgaaaccgaacttccagccgatccggaggagacc
gctacgcctgagcctcgtcccgcccgctctcgcgaccgcggcggcaaggtcgatgtcatg
ggcgtcggcatcagccatcccgacaaggctttgtggccaaatgcgggggatgatcgcccc
gtttcgaagcaggatctggccgagtattttgcggcggtaggcgagtggatgttgccgcac
atcaaggggcgcccctgctcgctcgtacgcgcgcccgacgggatcgacggcgagatgttc
ttccagcgccatgccggcatgggcacgtcgaacctgttcgaactcgtccgcgtcttcggc
gacaagaagccctatcttcagatcgatcggatcgaggccctggccgctgcagcccagatc
ggaggcatcgagcttcacccctggaactgcgcacccggcgatccggaggttccagggcgc
ctcgtcttcgacctcgatccgggaccgggcgtcagttttggcgacgtgatcgatgcggcc
aagcagatgcgcgagaggttggaggcgctcggcctcaccagtttctgcaagacgaccggc
ggcaagggcttgcacgtcgtcgcgccactggcgcccggcaagcgcagcaaggtcgactgg
ccggctgcgaaggatttcgcgcgtcgcgtctgtgcggatttggccagcgaggaaccctcg
cgctacgtcgtcaacatggccaagcgcctgcgcaacggccgcatcttcctcgactacctc
cgcaacgaccggatggcgacggcggttgcgccgctctcgccacgggcgcgacccggtgcg
catgcctcgatgccgctgacctggtctcaggtcaaatccggtctcgatcccagtcgtttc
acagtgaggaccctgcctggcctgctcaagaagacgggggcctgggaggggtatgacgac
gcggccggctcgatcgcggatgcgatcaaaaagctgggaaagcgagccgaggcagcctga

DBGET integrated database retrieval system