KEGG   Bacillus weihaiensis: A9C19_13865Help
Entry
A9C19_13865       CDS       T04822                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bwh  Bacillus weihaiensis
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bwh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9C19_13865
  Energy metabolism
   00680 Methane metabolism
    A9C19_13865
Enzymes [BR:bwh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A9C19_13865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2911657..2914419)
Genome map
AA seq 920 aa AA seqDB search
MTTRVETNDTSLLLRRDVKALGHILGEILVHHGGTELLEKVEKLRMMAKSLRLNFEKETY
NELKQEIINLDSPMRRQIIRAFSIYFHLINAAESNHRIRRRREYQLQDDHVVQPASIESA
LHALKENDITESTIQEVLNTLSLELIITAHPTEATKRSVIEIQKRIGTILKSLDNTMLTK
KERKKLEDSLLNEVTILWQTDELRHRKPTVMDEVRNGLYYFDQTFFDVLPEIHQDLEDGL
SDQFPNHKWQVPNFLRFGSWIGGDRDGNPNVTPEVTWETLESHRELVLKKYQDSLTDLMK
RFSHSITRVEVSEELFANVEEEEQIYLKADKQWPVETELYRRKLAIILARLEAVGKSDVG
YKTSDELLEDLAIIERSVNKHQPAQRELKMLRKLIRQVQLFGFHLATLDIRNHSGEHEAA
ITEILRKVKVAEDYASLSEEDKIKTLESVLKDPRPVLLLNEDYSKETQEMLKVFTMIKKA
HDTFGKKSILVYLVSMTQAASDLLEVLVLAKEAGIYRLHADGTVESHLNVAPLLETVDDL
IAGPKIMETLFNMDVYRKHLSILGDSQEIMLGYSDGSKDGGTITANWKLYKAQLEIHDMA
KQYQIGLKFFHGRGGSLGRGGGPLNRSILSQPAETLGDGVKITEQGEVLSSRYLSEDIAY
RSLEQATSTLLEASVNLSKESEQQHLREPVWEQAMEEISEVSLKKYQSLVFEDPDFLTYF
TEATPLNELAELNIGSRPMKRKNRNRFEDLRAIPWVFAWTQSRQLLPGWYAAGTGLESFA
SKSTENLELLKRMYQEWTFFRSTIDNLQMALMKADITTAKEYTFLVNDKNIADRIFGNIV
DEYEKTKSILLQISGVKELLDHTPNIKESVHRRNPYVDPLNFLQVELIKELREQDEPNEE
LLTEVLLTISGIAAGLRNTG
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaagagttgaaacaaatgatacaagtctattgttacgtcgcgatgtaaaagct
ctaggacatattttaggtgaaatccttgttcatcatggaggaacagagctacttgaaaaa
gttgaaaagctaagaatgatggcgaaatcacttcgtcttaactttgaaaaagaaacgtat
aatgaactgaaacaagaaattatcaacttagattcaccaatgagaagacaaatcattcgt
gccttttcaatctatttccatcttattaatgccgcagaatctaatcaccgcatacgtcgt
agacgagaatatcagcttcaagatgaccatgtcgtacaaccagcttctattgaaagtgct
cttcatgcattaaaggaaaatgacattacagagagtactattcaagaagtattgaacacg
ctatcattagagctaattattacggcacacccgacagaagctacgaaacgttctgttatt
gaaattcaaaaacgtatcggaacgatcttgaagagcttggataatacgatgttaacgaag
aaggaacgtaaaaaactagaggatagtcttctgaacgaagtgacaattctttggcaaacg
gatgaattacgtcatcgtaaaccaacagtaatggatgaggttcgtaatggactttattat
tttgatcaaacgttttttgatgttcttcctgaaattcatcaagatttagaggatggacta
tctgatcaattcccaaatcataaatggcaggtgcctaacttcttacgcttcggatcttgg
attggtggcgaccgagacggtaaccctaatgttacaccagaggtaacgtgggaaacatta
gaaagtcatcgagagcttgtgttaaagaaatatcaagattctttaacagatttgatgaag
cgtttcagccactcgattactcgtgtagaagtgtcggaagagctgtttgcaaatgtggaa
gaagaggaacaaatctaccttaaggcagacaaacagtggcccgtggaaacagaattatat
cgacgtaagctagcgataatcttagctcgtttagaagcggttggtaaatccgatgttggc
tataaaacttccgatgaactactagaggatctagctattattgaacgaagtgtgaataaa
catcagcctgcacaacgtgagctgaaaatgttaagaaagcttattcgccaagttcagtta
ttcggtttccatttagcaacgcttgatattagaaatcatagtggagaacatgaggcagct
attacagaaattttgcgtaaagtaaaggttgcagaagattatgcatctctatcagaggaa
gataaaattaagacattagaaagtgtcctaaaggatcctcgtcccgtactattactaaat
gaagactattcaaaagaaacgcaagaaatgcttaaagtctttacaatgattaaaaaggct
cacgatacgtttgggaaaaaatcaatcctcgtttatcttgtgagtatgactcaagcagca
agtgatctattggaggtacttgttcttgcgaaagaagcaggaatttatcgtttgcatgca
gacggtacagtagaaagtcatttaaatgtggcaccacttcttgaaacggtagatgatctt
attgcaggtcctaaaattatggaaacgttatttaatatggatgtatatcgtaagcactta
tctattttaggtgattctcaggaaatcatgcttggatattctgatggaagtaaagatggg
ggaacgattactgctaactggaagctttataaggctcagcttgagattcatgatatggcg
aagcaatatcaaattggtttaaagttcttccatggacgtggtggttcacttggacgtggt
ggcggtccattaaaccgtagtatcctatctcaaccagcagaaacattaggagatggagtg
aaaattacagaacagggtgaagtgttatcttcacgttacttaagtgaagatattgcttat
cgaagcttagagcaagcaacttctacattattagaggcttctgttaacctatcaaaagag
tctgaacaacaacatcttcgtgaacctgtatgggaacaggccatggaagagatatctgaa
gtatccctgaagaaatatcaatcattagtattcgaggatccagatttcttaacctatttt
acagaggcaactccattgaacgaattagctgaattaaatataggatcacgcccgatgaag
cgtaaaaaccgtaaccgttttgaagatttacgtgcaatcccgtgggtttttgcatggacg
caaagtcgtcagctattaccaggctggtacgcagcaggaacaggtctagaaagctttgct
tcaaaaagtacggagaatttagagctgttaaagcgtatgtatcaggaatggacattcttc
cgttcaacgattgataaccttcaaatggcattaatgaaagcagatattacaacagctaag
gaatatacgttcttagttaatgacaagaacattgctgatcgtatttttggaaatattgtg
gatgaatacgaaaaaactaaatcaatcttacttcaaatttctggagttaaagaactgtta
gatcatacaccaaatattaaagaatccgttcaccgaagaaacccttatgttgacccactt
aatttcctacaagtagagttaattaaggagcttcgtgagcaagatgaaccaaatgaagaa
cttctaacagaagtgttactaacaattagcggaatcgctgcaggtttacgtaacacaggt
tga

DBGET integrated database retrieval system