KEGG   Bacillus mycoides WSBC 10204: bwei_4448Help
Entry
bwei_4448         CDS       T03453                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
bww  Bacillus mycoides WSBC 10204
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bww00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    bwei_4448 (tdk)
Enzymes [BR:bww01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     bwei_4448 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4224179..4224763
Genome map
AA seq 194 aa AA seqDB search
MYLMNQNGWIEVICGSMFSGKSEELIRRIRRTQFAKQHAIVFKPCIDNRYSEEDVVSHNG
LKVKAVPVSASKDIFNHVTEEMDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDF
RGLPFGQVPQLMAIAEHVTKLQAVCSECGSPASRTQRLIDGEPAAFDDPIILVGASESYE
PRCRHCHAVPTKQR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtacttaatgaatcaaaatggttggattgaagtgatttgcgggagtatgttttctggg
aaatcagaagagctcatccgccgtatacgccgtacacaatttgcgaaacaacatgcgatt
gtatttaaaccatgtattgataatcgttatagtgaagaagatgttgtatcacataatgga
ttaaaggttaaagcagttcctgtttcagcttcaaaagatatatttaaccatgtaacagaa
gaaatggatgttattgcaatcgatgaggtacaattttttgatggggacattgtggaagtg
gtgcaagtattggcaaatcgtggctatcgtgtcattgtagctggattagaccaagatttc
cgtggtctaccatttggacaagttcctcagctgatggcgattgctgaacatgtaactaaa
ttgcaggcagtttgttctgaatgtggatctcctgcaagtcgtacgcaacgtttaatcgat
ggagaaccagcggcatttgatgatccaattattttagttggggcttcagaatcgtatgaa
ccacgttgtcgtcattgtcatgcagtacctacaaaacaaagataa

DBGET integrated database retrieval system