KEGG   Paraburkholderia xenovorans LB400: DR64_2468Help
Entry
DR64_2468         CDS       T03290                                 

Gene name
tuf
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
bxb  Paraburkholderia xenovorans LB400
Brite
Translation factors [BR:bxb03012]
 Eukaryotic Type
  Elongation factors
   DR64_2468 (tuf)
 Prokaryotic Type
   DR64_2468 (tuf)
Mitochondrial biogenesis [BR:bxb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    DR64_2468 (tuf)
Exosome [BR:bxb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DR64_2468 (tuf)
  Exosomal proteins of breast cancer cells
   DR64_2468 (tuf)
  Exosomal proteins of colorectal cancer cells
   DR64_2468 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:2708107..2709297
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTQKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDETPIIKGSAKLALE
GDKGELGEVAIMNLADALDTYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRVERGVVK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
INPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLINPIAMEEGLRFAIREGGRTVGAGVVAKILE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaagggtaagtttgagcggaccaagccgcacgtgaacgtcggcacgatcggtcac
gttgaccacggcaagaccacgctgacggcagcgatcacgacggttctgacgcagaagttt
ggcggcgaagcgaaggcatacgaccagatcgacgcggcgccggaagagaaggcgcgtggt
atcacgatcaacacggcacacgtcgagtacgaaacggctaaccgccactacgcacacgtc
gactgcccgggccacgctgactatgtgaagaacatgatcacgggcgcagcgcagatggac
ggcgcgatcctggtgtgctcggccgctgacggcccgatgccgcaaacgcgcgagcacatc
ctgctggcgcgtcaggttggcgtgccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgctgagctgctggagctggtcgagatggaagttcgcgaacttctgtcgaag
tacgacttcccgggcgacgagacgccgatcatcaagggttcggcgaagctggcgctggaa
ggcgacaagggcgagctgggcgaagtggcgatcatgaatctggccgacgcgctggacacg
tacatcccgacgccggagcgcgcagttgacggtgcgttcctgatgccggtggaagacgtg
ttctcgatctcgggtcgcggtacggtggtgacgggtcgcgttgagcgcggcgtcgtgaag
gtcggcgaggaaatcgaaattgtcggtatcaagccgacggtgaagacgacctgcacgggc
gtggaaatgttccgcaagctgctcgatcaaggtcaggcgggcgacaacgtgggtatcctg
ctgcgcggcacgaagcgtgaagacgtggagcgtggccaggtgctggccaagccgggttcg
atcaacccgcacacgcacttcacggctgaagtgtacgtgctgagcaaggacgaaggtggc
cgtcacacgccgttcttcaacaactatcgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgagttgccgaaggacaaggaaatggtcatgccgggcgacaacgtgtcg
atcacggtgaagctgatcaacccgatcgcgatggaagaaggtctgcgtttcgcaatccgc
gaaggcggccgtacggtcggtgcaggtgtggttgccaagattctcgagtaa

DBGET integrated database retrieval system