KEGG   Paraburkholderia xenovorans LB400: Bxe_C0551Help
Entry
Bxe_C0551         CDS       T00340                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00250  Alanine, aspartate and glutamate metabolism
bxe00410  beta-Alanine metabolism
bxe00430  Taurine and hypotaurine metabolism
bxe00650  Butanoate metabolism
bxe01100  Metabolic pathways
bxe01110  Biosynthesis of secondary metabolites
bxe01120  Microbial metabolism in diverse environments
bxe02024  Quorum sensing
Module
bxe_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Bxe_C0551
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bxe_C0551
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bxe_C0551
   00430 Taurine and hypotaurine metabolism
    Bxe_C0551
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Bxe_C0551
Enzymes [BR:bxe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Bxe_C0551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ABE36450
JGI: BxeC0551
UniProt: Q13HI9
LinkDB All DBs
Position
3:569598..570983
Genome map
AA seq 461 aa AA seqDB search
MTFLKSPPPTPDAVADEYAAMISGSSLPKYRIPEASSDRRAVFDLVRDELFMDGNSRQNV
ATFCTTYADDEVRRLMDLSIDKNMIDKDEYPQTAEIEMRCVHMLADLWHATKSWKTTGCS
TTGSSEACMLGGLALKWQWKKRREAQGKPTGKPNFVCGPVQVCWAKFARYFDVEMRQVPL
SGDATGLRPEDLAQYCDENTIGVVATLGITFTCVYEPVKALAGALDALQANVGLDIPIHV
DAASGGFVAPFIQPDLEWDFSVPRVKSINASGHKYGLAPLGVGWIVWRSTQDLPDELIFR
VDYLGGDMPTFALNFSRPAGQIIAQYYMLLRLGREGYRHIQQECADTAQALADGLAKIDA
LDMIYDGRGALPAVCYKLKHPDTAGFTLFDLSDRVRMRGWQIASYELPAGREDTIVQRVL
IRRGVTRDMAAMLLEDIKHAIAHLTKNPVPNSTAGPTFHHD
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgacctttctcaagtccccgccacccacgcccgatgccgtcgccgacgaatacgccgcg
atgatctccggttcttcactaccgaagtaccggatcccggaagcatcgtccgatcgccgc
gccgtattcgatctggtgcgcgacgaactgttcatggacggcaactcacggcagaacgtc
gcgaccttttgcactacatatgccgacgacgaagtgcgccgcctgatggatctgtcgatc
gacaagaacatgatcgacaaggacgaatatccgcaaaccgccgaaattgaaatgcgctgc
gtgcatatgcttgccgatctgtggcatgccacgaagtcgtggaagaccaccgggtgttcg
acgacgggttcgagcgaggcctgcatgctcggtggtctcgcgctcaagtggcagtggaaa
aagcgtagggaagcgcagggtaagccgaccggcaagccgaacttcgtctgcggacccgtg
caggtatgctgggcgaagttcgcccgctacttcgacgtcgagatgcgccaggtgccgctc
agcggcgatgcgaccggactacggccggaagatctggcccagtactgcgacgagaacacg
attggcgtcgtcgccacgctcggcatcacgttcacctgcgtctatgaaccggtgaaggcg
ctggcaggcgcgctcgacgccttgcaagccaatgtcgggctcgatattcccattcacgtc
gatgcggctagcggcggcttcgtcgcaccgttcattcagcctgacctcgaatgggacttc
agcgtgccacgcgtcaagtcgatcaatgcgtcgggccataaatacgggctcgcgccgctc
ggcgtcggctggatagtctggcgcagcacccaggatttgcctgacgaactgattttccgg
gtcgattatctgggcggcgacatgccgacgtttgcattgaatttctcgcggccggccggc
cagatcatcgcgcagtactacatgctgctgcgcctgggccgagagggctaccggcacatc
cagcaggagtgcgccgataccgcgcaagcgctggccgacggtctcgcgaagatcgacgcg
ctcgacatgatctacgacgggcgaggcgcgttgccggccgtttgctacaagctgaagcat
ccggataccgcgggcttcacactgttcgatctgtccgaccgggtacgcatgcgcggctgg
cagatcgcgtcatacgaactgcctgccgggcgcgaggacaccatcgtgcaacgcgtactg
atccggcgcggcgtgacccgcgacatggcagcgatgctgcttgaggacattaaacacgcg
atcgcgcatctgacgaagaacccggtgccgaattcgaccgccggcccgaccttccatcac
gactga

DBGET integrated database retrieval system