KEGG   Bacillus amyloliquefaciens XH7: BAXH7_01898Help
Entry
BAXH7_01898       CDS       T01836                                 

Gene name
amyX
Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bxh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BAXH7_01898 (amyX)
Enzymes [BR:bxh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BAXH7_01898 (amyX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(1845832..1847376)
Genome map
AA seq 514 aa AA seqDB search
MIQKRKRTVSFRLVLMCTLLFVSLPITKTSAVNGTLMQYFEWYTPNDGQHWKRLQNDAEH
LSDIGITAVWIPPAYKGTSQSDNGYGPYDLYDLGEFQQKGTVRTKYGTKSELQDAIGSLH
SRNVQVYGDVVLNHKAGADATEDVTAVEVNPANRNQETSGEYQIKAWTDFRFPGRGNTYS
DFKWHWYHFDGADWDESRKISRIFKFRGEGKAWDWEVSSENGNYDYLMYADVDYDHPDVV
AETKKWGIWYANELSLDGFRIDAAKHIKFSFLRDWVQAVRQATGKEMFTVAEYWQNNAGK
LENYLNKTSFNQSVFDVPLHFNLQAASSQGGGYDMRRLLDGTVVSEHPEKAVTFVENHDT
QPGQSLESTVQTWFKPLAYAFILTRESGYPQVFYGDMYGTKGTSPKEIPSLKDKIEPILK
ARKEYAYGPQHDYIDHPDVIGWTREGDSSAAKSGLAALITDGPGGSKRMYAGLKNAGETW
YDITGNRSDTVKIGSDGWGEFHVNGGSVSIYVQK
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaaaacgaaagcggacagtttcgttcagacttgtgcttatgtgcacgctgtta
tttgtcagtttgccgattacaaaaacatcagccgtaaatggcacgctgatgcagtatttt
gaatggtatacgccgaacgacggccagcattggaaacgattgcagaatgatgcggaacat
ttatcggatatcggaatcactgccgtctggattcctcccgcatacaaaggaacgagccaa
tccgataacggatacggaccttatgatttgtatgatttaggagaattccagcaaaaaggg
acggtcagaacgaaatacggcacaaaatcagagcttcaagatgcgatcggctcactgcat
tcccggaacgtccaagtatacggagatgtggttttgaatcataaggctggtgctgatgca
acagaagatgtaactgccgtcgaagtcaatccggccaatagaaatcaggaaacttcgggg
gaatatcaaatcaaagcgtggacggattttcgttttccgggccgtggaaacacgtacagt
gattttaaatggcattggtatcatttcgacggagcggactgggatgaatcccggaagatc
agccgcatctttaagtttcgtggggaaggaaaagcgtgggattgggaagtatcaagtgaa
aacggcaactatgactatttaatgtatgctgatgttgactacgaccaccctgatgtcgtg
gcagagacaaaaaaatggggtatctggtatgcgaatgaactgtcattagacggcttccgt
attgatgccgccaaacatattaaattttcatttctgcgtgattgggttcaggcggtcaga
caggcgacgggaaaagaaatgtttacggttgcggagtattggcagaataatgccgggaaa
ctcgaaaactacttgaataaaacaagctttaatcaatccgtgtttgatgttccgcttcat
ttcaatttacaggcggcttcctcacaaggaggcggatatgatatgaggcgtttgctggac
ggtaccgttgtgtccgagcatccggaaaaggcggttacatttgttgaaaatcatgacaca
cagccgggacagtcattggaatcgacagtccaaacttggtttaaaccgcttgcatacgcc
tttattttgacaagagaatccggttatcctcaggtgttctatggggatatgtacgggaca
aaagggacatcgccaaaggaaattccctcactgaaagataagatagagccgattttaaaa
gcgcgtaaggagtacgcatacgggccccagcacgattatattgaccacccggatgtgatc
ggatggacgagggaaggtgacagctccgccgccaaatcaggtttggccgctttaatcacg
gacggacccggcggatcaaagcggatgtatgccggcctgaaaaatgccggcgagacatgg
tatgacataacgggcaaccgttcagatactgtaaaaatcggatctgacggctggggagag
tttcatgtaaacggagggtccgtctccatttatgttcagaaataa

DBGET integrated database retrieval system