KEGG   Burkholderia sp. YI23: BYI23_B007640Help
Entry
BYI23_B007640     CDS       T01711                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
byi  Burkholderia sp. YI23
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BYI23_B007640
Enzymes [BR:byi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BYI23_B007640
Transporters [BR:byi02000]
 Other Transporters
  Pores ion channels [TC:1]
   BYI23_B007640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:complement(882545..883216)
Genome map
AA seq 223 aa AA seqDB search
MLTVHHLNNSRSQRVLWMLEELGVEYELKRYQRDPRTMLAPPELRAVHPLGKSPVVTDGD
LTLAESGAIIDYLVERYGDGRFSPPPGTSAERVRYNYWMHYAEGSAMPPLLLKLVARRLE
SAKMPFFARPIARRIAQTMQSSFIDPQLRLHFGFIEAELAKSTWFAGETFSAADVQMSFP
LETGGQRAGAKSMPHIRAFLERIHARPAYQRALERGGRYDFAA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgtccaccacctcaacaactcccgctcccagcgcgtgctctggatgctcgaa
gagctcggcgtcgaatacgagctgaagcgctatcagcgcgatccgcgcaccatgctcgcg
ccgcccgaactgcgcgcggtgcatccgctgggcaaatcgccggtcgtcaccgacggcgac
ctcacgctcgctgagtcgggcgcgatcatcgactatctggtcgagcgttatggcgatggg
cgcttttcgccgccgccgggcacatcggccgaacgcgtgcgctacaactactggatgcat
tacgcggaaggctcggccatgccgccgcttttgctcaagctcgtcgcgcgccgtctggaa
agcgcgaagatgccgttcttcgccaggccgatcgcgcggcgcatcgcgcagacgatgcaa
agcagtttcatcgatccgcaattgcggttgcacttcggctttatcgaagcggagcttgca
aaatcgacgtggttcgcgggcgaaaccttcagcgccgccgacgtccagatgagttttccg
ctcgaaaccggcggccagcgcgccggcgcgaaatcgatgccgcatatccgcgcgtttctc
gaacgcattcacgcgcggcccgcataccagcgtgcgctcgagcgcggcgggcgctacgac
ttcgccgcctga

DBGET integrated database retrieval system