KEGG   Bipolaris zeicola: COCCADRAFT_21344Help
Entry
COCCADRAFT_21344  CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bze  Bipolaris zeicola
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bze00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    COCCADRAFT_21344
Enzymes [BR:bze01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     COCCADRAFT_21344
Transporters [BR:bze02000]
 Other Transporters
  Pores ion channels [TC:1]
   COCCADRAFT_21344
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 269 aa AA seqDB search
MGKDHPDADLHPEATGLAAATVKAHSAECPLKLYSGWFCPFVQRVWIAFEEKGIQYQYIE
VNPYHKPQSLLDLNPRGLVPTLQYQGKPLYESTVLCEFLEEAFPQHTPHLMPTDPYERAR
TRIWTDYVGSRIIPAYHRFLQHQGDGLEEKQKEFLNHIKEFTREMDNEGPFFSGKEFGLI
DIVIAPWANRLWVFDHFKGGSGIPDEGKGGEDEEVWKRFRKWLAAVEARKSVKETLSDRQ
HYLPIYQRYAEDRAQSEAAKAIRAGRGIP
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagaccaccctgatgcggaccttcacccagaggctacaggcctggcagcagcg
acagtcaaggctcactcagccgagtgtcctctaaagctctactcgggctggttttgcccc
tttgttcagcgtgtatggattgccttcgaggaaaaaggcatccaatatcaatacattgaa
gtcaacccatatcacaagccccagtccctgcttgatcttaatcctcgcggccttgttccc
acactgcaataccagggcaagccgctatatgagagcactgttctttgcgagtttctcgag
gaagcatttccacagcacacaccgcacctgatgcctacggatccctatgagcgtgcgaga
acaagaatctggacagattatgtgggtagtcgcatcattcccgcctaccaccgcttcctc
cagcatcaaggcgatgggctcgaagaaaagcagaaggaattcttgaatcacatcaaggag
ttcacgcgagagatggacaacgaaggaccgtttttctcaggcaaggaatttggactcatt
gacattgtgattgcgccctgggccaacaggctatgggtctttgatcacttcaaagggggt
tcgggtattcctgacgagggcaagggcggtgaggatgaggaggtatggaagaggttcagg
aagtggctcgctgctgttgaggctaggaaaagtgtcaaggaaacgttgagtgacaggcag
cactatttgcccatttatcagcgatatgcagaggaccgggcccagagtgaggctgcaaaa
gcaattcgggctggcaggggaattccttag

DBGET integrated database retrieval system