KEGG   Bipolaris zeicola: COCCADRAFT_35005Help
Entry
COCCADRAFT_35005  CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K02358  
elongation factor Tu
Organism
bze  Bipolaris zeicola
Brite
Translation factors [BR:bze03012]
 Eukaryotic Type
  Elongation factors
   COCCADRAFT_35005
 Prokaryotic Type
   COCCADRAFT_35005
Mitochondrial biogenesis [BR:bze03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    COCCADRAFT_35005
Exosome [BR:bze04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   COCCADRAFT_35005
  Exosomal proteins of breast cancer cells
   COCCADRAFT_35005
  Exosomal proteins of colorectal cancer cells
   COCCADRAFT_35005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 443 aa AA seqDB search
MSSFSKVFLRTSRAAVQYQRGVSPVQNALGAQGTSRWMNGVRNYAAFTRDKPHVNIGTIG
HVDHGKTTLTAAITKRQAEKGFAKYLDYGSIDKAPEERKRGITISTAHIEYQTENRHYAH
VDCPGHADYIKNMITGAANMDGAIIVVAASDGQMPQTREHLLLARQVGVQKIVVFVNKVD
AVEDKEMLELVEMEMRELLSSYGFEGDETPIVMGSALCAIENRQPEIGVTKIDELLEAVD
SWIPTPQRETDKPFLMAVEDVFSIAGRGTVVSGRVERGILKRDAEVELVGKGTAPIKTKV
TDIETFKKSCEESRAGDNSGLLLRGVKRDEVRRGMVVSVPGQVKAHKKFLVSMYVLSKEE
GGRHTGFGENYRPQMFIRTADESCALFWPEGTEDAHEKLVMPGDNVEMVCELHAPHVLET
GQRFNMREGGRTVATGLVTRVLE
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcttttcaaaggttttcctgcgcacttcgcgtgctgccgtgcagtaccagcgt
ggcgtctcgccggtgcagaatgccttgggtgcgcagggcaccagcaggtggatgaacggc
gtccgcaactacgccgcctttacacgagacaagcctcatgttaacattggtacgattggc
cacgtcgatcacggaaagaccactctcacagccgccatcaccaagcgacaagcagaaaag
ggctttgctaaatacctcgactatggctccattgacaaggcccccgaagagcgcaagcgt
ggtatcacaatctcgaccgcccacattgagtaccaaaccgaaaaccgccactacgcccac
gtcgactgccccggtcacgctgattacatcaagaacatgattacgggagccgccaacatg
gacggtgccattattgttgttgccgcttccgacggtcagatgccccagacccgtgagcac
ttgctgctcgcccgccaggtcggtgtccagaagatcgttgtcttcgtcaacaaggtcgac
gctgttgaggacaaggaaatgttggagcttgtcgagatggaaatgcgcgaactgcttagc
agctatggctttgagggtgacgagacccccattgtcatgggctctgccctctgtgccatt
gagaaccgccagccggaaattggtgtcaccaagattgacgagctgctcgaggccgtcgat
tcatggattcctactcctcagcgtgagactgacaagcctttccttatggccgtcgaggac
gtcttctccattgctggtcgtggtaccgtcgtttctggccgtgttgagcgaggtattctg
aagcgcgatgctgaagtcgagcttgtcggcaagggtaccgcgcccatcaagaccaaggtt
accgacattgagaccttcaagaagtcttgtgaagagtctcgcgctggtgacaactctggt
cttcttctacgtggtgtcaagcgtgacgaagttcgtcgtggtatggtcgtttccgtcccc
ggacaggtcaaggctcacaagaagttcctcgtctccatgtacgtcttgagcaaggaggag
ggtggtcgccacactggtttcggcgagaactacaggccacaaatgttcatccgcactgct
gatgagtcgtgtgcgctgttctggcccgaaggtaccgaggatgcccatgagaagcttgtc
atgcctggtgacaacgtcgagatggtttgcgagctccatgcaccacacgtcttggagact
ggccagcgcttcaacatgcgtgagggtggccggacagtcgctactggtttggtgacgcgt
gttctggagtag

DBGET integrated database retrieval system