KEGG   Caldithrix abyssi: Cabys_140Help
Entry
Cabys_140         CDS       T04549                                 

Definition
(GenBank) tdk thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
caby  Caldithrix abyssi
Pathway
caby00240  Pyrimidine metabolism
caby01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:caby00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Cabys_140
Enzymes [BR:caby01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Cabys_140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK ATPase_2 TAF8_C
Motif
Other DBs
NCBI-ProteinID: APF16891
UniProt: H1XU17
LinkDB All DBs
Position
161575..162156
Genome map
AA seq 193 aa AA seqDB search
MMHVVHRHTGWIEVICGSMFSGKTEELIRRLKRAMIARQKVAIFKPKVDTRYSTTEIVSH
DKQKIKSIVVESPQEILEKALEAQVVGIDEAQFFDDSLVNICQKLANMGKRVIIAGLDQD
YLGKPFEPIPQLLAVAEYITKTHAICVVCGNPANHTYRKTKQKDKVIVGASNIYEARCRN
CFHAPEEDEEEEK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatgcatgtggtacaccggcacacgggctggatcgaagttatttgcggcagcatgttc
agcggcaaaaccgaagagttaatacgccgcttaaaacgagcgatgattgccaggcaaaaa
gtggctattttcaaaccgaaggtagatacgcgctacagcacaaccgaaatcgtatcgcac
gacaaacaaaaaatcaaatcgattgtggtggaaagtccgcaggaaattctggaaaaagca
ttggaggcccaggtggttggcatcgacgaagcgcagttttttgacgattctctggtcaac
atctgccaaaaactggctaacatgggcaaacgcgtaattattgccggtctggatcaggat
tacctgggcaaaccctttgagcccatcccgcaactgctggccgttgccgaatacattacc
aaaacgcacgccatttgcgttgtttgtggcaatccggccaatcacacctatcgtaagacc
aaacaaaaagataaagtcattgtaggcgcttcgaatatttacgaagcgcgctgccgtaac
tgttttcacgctccggaagaagatgaagaagaggagaaataa

DBGET integrated database retrieval system