KEGG   Clostridium acetobutylicum ATCC 824: CA_C2567Help
Entry
CA_C2567          CDS       T00056                                 

Definition
(RefSeq) Fe/Mn family superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cac  Clostridium acetobutylicum ATCC 824
Brite
Enzymes [BR:cac01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CA_C2567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2670405..2671067
Genome map
AA seq 220 aa AA seqDB search
MITEKKYNFNSLAGFSNELLKAHYDIYVNYINDLNKLWKVSYTPGFRSDDTNHSLMRSLK
SKEIYTLNGIKLHELYFENMTGKNTKPYGPILKEIGKQFSSYNNFISYLTEVAISMKGWV
ILSIDSLDGRFHLFGNDFHDTSAILASHPLMVLDVQEHSYFKDFINDKGKYVETFINNLD
WKILNDRFKAYIFQNKLRTLSRSDGDFGVCPFMSMQDTFY
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgataactgaaaagaaatataattttaattcactagctggttttagtaatgaactttta
aaagctcattatgatatatatgtaaactatattaacgatttaaataaactgtggaaagta
tcctatactcctggttttagaagcgatgatactaatcactctttaatgagaagcctaaaa
tcaaaagaaatatatactctaaatgggataaaacttcacgaactatactttgaaaatatg
acaggtaaaaatacaaagccctatggacctattttaaaggagataggaaaacaattttct
tcttataacaattttatttcttatttaactgaagttgctatttccatgaagggttgggta
atactttctatagattccttagatggaaggtttcatttatttggaaatgattttcatgat
acaagtgcaattttagcctctcacccactaatggttttagatgttcaggagcattcttat
tttaaggattttattaatgataaaggtaaatatgttgaaacttttattaataatcttgac
tggaaaatattaaatgataggttcaaagcctatatttttcaaaataaattaaggactcta
tctagatctgacggtgactttggagtatgtccctttatgtctatgcaggataccttttat
taa

DBGET integrated database retrieval system