KEGG   Cutibacterium acnes: RN83_03985Help
Entry
RN83_03985        CDS       T04624                                 

Definition
(GenBank) sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
cacn  Cutibacterium acnes
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cacn00001]
  Lipid metabolism
   00600 Sphingolipid metabolism
    RN83_03985
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    RN83_03985
Enzymes [BR:cacn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     RN83_03985
Bacterial toxins [BR:cacn02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   RN83_03985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(858795..861110)
Genome map
AA seq 771 aa AA seqDB search
MTITDTYTEELAIDLTGSALLPARKGMDVQRIDGEDGSLLVEFSATSSGCLFELVGKNGR
LSVDVDADRLLGRIDLNGETRSLDAEDALGMADGTIHSVGLTADETGTHLFADGYETFSA
TLRAWCQDLGATNVVINPSGVLDVRRFRMWNSALSLQAMAAKAPAATPFVEFAGSELSAR
DARRTGELTHGALRARTRLRGKGQGGTVLAAQGSAGELSFEIVDGDLLLHVEVDDEPIAH
VRAPGKWDDGNWHDLVAISGRGAIDLYVDGFLVAHEPGEAFLADLGKVERVTVGKDLEGA
RLFGEAQTASIFSSALTDAQVKRLANVAPLRTQALFDTGYLGSKSYRIPSLIRLDSGSFI
AGADQRVSIANDSPNDINFVIRRSEDGRRWDEAQIVLEYPGEGALGASVIDSVLFQDHNS
GRVFCLIDQFPGGVGQPNAEPGSGFDEQGRQLLFDRDATAYVVDAEGIVTTESGEPTDYT
IDETGNVFVAGTPAGNIHLAAGVDPHESLLTLRTCNLILIHSDDDGRTWSRPINLNPALK
QPWMRFLGTSPGNGIQLEHGTHRGRLLAPVYYNHEEGKTFSCAAVYSDDEGQTWNLGKSP
NDERELFGKIVSSRHLNDDRGSTHESALVETPDGVVHSFMRNQHPSGRVAHAASIDGGET
WGEVTFVEQLTEIFSQPNAISVRDECGTESVVFANASMMLPFRGCGVLRQSFDGGKTWPH
NRVLNPRHHVYQCMTQRDEQTLLVLWEREWQGLFLTEVPLSWLTTSRSTLE
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgactattactgatacttataccgaggaattggcgattgacctcaccggaagcgccttg
ctgccggcccgaaagggcatggacgtgcaacgaatcgacggcgaggacggctcacttctc
gtggaattcagcgcgacgtcctccggatgcctgttcgagcttgtcggaaagaacggacgg
ttatcagtcgatgtggatgcagaccgcttgcttggccgtatagatctgaacggagaaact
cgcagtctcgacgccgaggatgcgctaggcatggcagatggcacgattcactccgtcgga
ctcaccgccgatgaaactgggacgcatttgtttgcagacggttacgaaacattctccgcc
acattgcgggcatggtgccaggacctgggagcaaccaatgtcgtcatcaatccgtcgggc
gtcctcgacgtacggcgattcaggatgtggaactcagccctatccttgcaagctatggcg
gccaaggcgccggcggcaacaccgttcgtcgagttcgctggttctgagctgtcggcccgc
gacgcacgccgtaccggagaactcactcatggcgcactccgagcaaggacccgccttcgt
ggcaaaggccagggtggaaccgtcctcgcagcccaagggagcgccggtgaactgtccttc
gagatcgtcgacggcgacctgctcctgcacgtggaagtggacgatgaacccatcgcccac
gtgcgcgctccaggcaagtgggacgacggaaactggcatgacctggtagcaatcagtggc
aggggcgccattgatctctatgttgacggtttcctcgtggctcacgagcctggtgaggca
ttccttgccgatcttggcaaggtcgaaagggtgaccgtcgggaaggacctcgaaggagca
cggctattcggggaagcgcagacggcatccatcttcagcagtgcgctgaccgacgcccaa
gtcaaacgcctagccaacgtggctcctctacgtacccaagctctcttcgacacgggatat
ttgggctcgaaaagttaccggatcccatcgctaatcagacttgattccggaagctttatc
gccggggcagaccaacgcgtcagcattgccaacgacagccctaacgacatcaatttcgtc
atccgtcgcagcgaagacggtcgtcggtgggacgaggctcagatagtcctcgagtatccc
ggcgagggcgccctcggagcatcggttatcgactcagttctgttccaagaccacaactcg
ggacgcgtgttctgcttgatcgaccagttcccgggtggcgtagggcagcctaacgccgaa
ccagggtcgggcttcgatgagcaaggtcggcagcttctgttcgaccgcgatgcaaccgcc
tacgtcgtcgatgcagaaggcatcgtgacaaccgagtcgggggaacccacggactacacc
attgacgaaaccggaaacgtcttcgtggccggtacccccgccggcaatatccacttggcc
gccggagtggacccccacgagtctctgctgaccctacggacctgcaacctcatcctcatc
cacagtgatgacgacggacggacgtggtcacgacctatcaacctgaacccggctctcaaa
cagccttggatgcggttcctcggtacttcaccgggcaacggaattcagttggaacacggg
acgcaccgaggccgactcctggcaccggtttactacaaccatgaggagggaaaaaccttt
tcatgtgccgcggtgtacagcgatgacgagggccagacatggaatctcggtaagtcacca
aacgacgagcgcgaactgttcggaaagatcgtcagttctcgacatctcaacgatgatcgc
ggctcgacccatgagtcagcgttggtagaaacccctgacggtgtcgtgcactcctttatg
cgcaaccaacatccctccggacgggtggcgcatgcagccagcatcgacggtggcgaaaca
tggggcgaggtgacgttcgtcgagcagctgaccgaaatcttctcccagcccaatgccatc
tctgtccgggatgagtgtggaaccgaatcggtggtcttcgccaatgcgtcgatgatgctc
ccgttccggggttgtggtgtattgcgtcaaagtttcgacggaggcaagacctggccgcac
aaccgcgtgctcaaccctcgccatcatgtgtaccaatgcatgacccagcgagacgaacag
actctgctcgtgttgtgggaacgggagtggcaaggcctgttcctgacagaggtcccgttg
tcatggctcaccacttcgcgcagcacgctggagtaa

DBGET integrated database retrieval system