KEGG   Clostridium acetobutylicum DSM 1731: SMB_G2602Help
Entry
SMB_G2602         CDS       T01548                                 

Gene name
sodB
Definition
(GenBank) Fe/Mn family superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cae  Clostridium acetobutylicum DSM 1731
Brite
Enzymes [BR:cae01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SMB_G2602 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2672031..2672693
Genome map
AA seq 220 aa AA seqDB search
MITEKKYNFNSLAGFSNELLKAHYDIYVNYINDLNKLWKVSYTPGFRSDDTNHSLMRSLK
SKEIYTLNGIKLHELYFENMTGKNTKPYGPILKEIGKQFSSYNNFISYLTEVAISMKGWV
ILSIDSLDGRFHLFGNDFHDTSAILASHPLMVLDVQEHSYFKDFINDKGKYVETFINNLD
WKILNDRFKAYIFQNKLRTLSRSDGDFGVCPFMSMQDTFY
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgataactgaaaagaaatataattttaattcactagctggttttagtaatgaactttta
aaagctcattatgatatatatgtaaactatattaacgatttaaataaactgtggaaagta
tcctatactcctggttttagaagcgatgatactaatcactctttaatgagaagcctaaaa
tcaaaagaaatatatactctaaatgggataaaacttcacgaactatactttgaaaatatg
acaggtaaaaatacaaagccctatggacctattctaaaggagataggaaaacaattttct
tcttataacaattttatttcttatttaactgaagttgctatttccatgaagggttgggta
atactttctatagattccttagatggaaggtttcatttatttggaaatgattttcatgat
acaagtgcaattttagcctctcacccactaatggttttagatgttcaggagcattcttat
tttaaggattttattaatgataaaggtaaatatgttgaaacttttattaataatcttgac
tggaaaatattaaatgataggttcaaagcctatatttttcaaaataaattaaggactcta
tctagatctgacggtgactttggagtatgtccctttatgtctatgcaggataccttttat
taa

DBGET integrated database retrieval system