KEGG   Clostridium acetobutylicum DSM 1731: SMB_P166Help
Entry
SMB_P166          CDS       T01548                                 

Gene name
amyA
Definition
(GenBank) Alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cae00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SMB_P166 (amyA)
Enzymes [BR:cae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SMB_P166 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
pSMBa:complement(181586..183868)
Genome map
AA seq 760 aa AA seqDB search
MSKRSKLLKRRMLSLSVICVLIGYGPVFNPVRSQAKVMTYSSENRELPENTKDGVMLHAF
DWSFNNIKKELPSIAAAGYKAVQVSPVQGTKSNSTNSSDWWLLYQPTNQAIGNAQLGSYD
DFKSLCSEAKNYGISIVVDVVMNHMANNGNDDEVASEVDPSFKDPSLYHHNGQCTDWNNR
QDVTQEGIGMPDLNTQSSAVQSKAITFLNQCVDAGATGFRFDAAKHIETDLGLDANKSWS
GNYWENVLGSLHNKSNLYIYGEVLQDGKVDNISAYESFMNVEASAYDGSLRGAIKSGDLT
NAQGMGGLDSNKCVDMLETHDEYEHNESKDLTDWQRKAGWAIAASRAGSVPLFFDRPTGN
IGSEGDALWKDSDVVAVNEFHNAMAGQNEYLRLQNNNKAMIIERGSKGAVIVNEGDSFNL
NTPTNLEDGNYDNHGSATDSLTVSQGRMTGTVPANSIIVIYNKNSNPGSDRVTLSEQAAK
AGDSVTITYDAGTTALKDASNVNLYWGYDGFSAATSKAMTSLGDNKWQTTITVPKEVTKN
VNFSFTDGTSWDNNNGANWNIPLASNYLPHAGYKVDYDSSNLVSGNNFTIYYNGNLANSS
NVSLHWGVNGWSNMQNLAMVKDSNGFWEATIAIPASSNTLNFCFTNGSSWDNNNNNNWTL
NTWSSVPKVQVTPAPEACKQISVYYNGSLASSASNITLHWGCNGFTSPQDINMVKQADGR
WLANITLPSGCYNVNMAFKDQSGTWDNNNSNNYNFSSTNN
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaaacgttctaaattgttaaaaagaagaatgctatcactgtcagtaatatgtgtt
ttaattggatatggacctgtgtttaatcctgttagatcacaagcaaaggtaatgacatat
tcaagtgagaatagagaacttccggaaaacaccaaagacggtgttatgcttcatgctttt
gactggtcatttaataatataaaaaaagaacttcctagtattgcagcagcaggttataaa
gctgttcaggtgtctccagttcaaggtacaaaaagcaatagtacgaattcttctgactgg
tggctattatatcagccaaccaatcaagctataggaaatgctcaacttgggagttacgat
gatttcaaatcactttgcagtgaagcaaaaaactatggaatatctatagttgttgatgta
gtaatgaatcatatggccaataatggaaacgacgatgaagttgcttctgaagtagatcca
agttttaaagatccaagcttgtatcatcataatggacagtgcactgattggaataataga
caagatgtaacacaggaaggtataggtatgccagatttaaatacacaaagttcagcagta
cagagtaaggcgattacttttttaaatcagtgtgtagatgctggtgcaaccggttttcgt
tttgatgctgctaagcatattgaaacagacttaggtttagatgctaataaatcttggtca
ggtaactattgggaaaacgttttaggcagtttgcataataaatcaaatctatatatttat
ggtgaggtacttcaagatggaaaagtagataatatttcagcttatgaaagttttatgaat
gttgaagcaagcgcatatgatggatctcttagaggtgcaattaaatcaggtgatttaact
aatgcgcagggcatggggggacttgatagtaataagtgtgtggatatgcttgaaacacat
gatgagtacgagcataatgaaagtaaagatttaacagactggcaaagaaaagcaggttgg
gcaatagctgcttcaagagctggttcagttcccttattctttgatagacctacaggaaat
ataggaagtgagggagatgctctctggaaggattctgatgttgtagctgttaatgaattt
cataacgcgatggcaggtcaaaatgaatatttaaggttacaaaataacaataaggcaatg
attatagaaagaggaagtaaaggagctgttattgtaaatgaaggcgacagctttaattta
aacaccccaactaatttagaggacggaaattatgataatcatggtagtgcaaccgattct
ttaactgtttctcaggggagaatgacaggaacagtaccagcaaattcaatcatagtgatt
tacaacaagaatagtaacccaggcagcgacagagttacattaagtgagcaagctgcaaaa
gcaggagatagtgtaacgataacttatgatgcgggaacaacagcgctaaaggatgcttca
aatgtaaacttgtactggggttatgacggttttagcgctgcaacaagtaaggcaatgaca
tcacttggagacaataagtggcagacaactataacagtgcctaaagaggttactaagaat
gttaatttttcttttacagatgggacaagttgggataataacaatggagctaattggaat
ataccattagccagtaattaccttccacatgcaggctataaagttgattatgacagcagc
aacctagtttcgggtaataattttacaatttactataatggaaacttagcgaattcatca
aacgtatccttgcactggggagttaacggatggagtaatatgcaaaacttagctatggta
aaggattcaaatggtttttgggaggctactatagcgatacctgcttcatcaaatacattg
aatttttgtttcacaaatggaagcagttgggataataataacaacaataattggacttta
aatacatggagcagtgtccctaaagttcaagttactccagcgccagaggcatgtaaacaa
atatcagtttattacaatggaagtttagcatcttcagcttctaatataacattacattgg
ggttgtaatggatttacgtcgcctcaggatataaatatggtaaaacaggcggatggaaga
tggcttgcaaatataactttaccttctggctgttataatgttaatatggcatttaaagac
cagtcaggtacatgggataataataacagtaataactataatttttcttcaacaaataat
taa

DBGET integrated database retrieval system