KEGG   Candida albicans: CAALFM_C111660WAHelp
Entry
CAALFM_C111660WA  CDS       T00189                                 

Gene name
GAD1, CaO19.1153
Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cal  Candida albicans
Pathway
cal00250  Alanine, aspartate and glutamate metabolism
cal00410  beta-Alanine metabolism
cal00430  Taurine and hypotaurine metabolism
cal00650  Butanoate metabolism
cal01100  Metabolic pathways
cal01110  Biosynthesis of secondary metabolites
Module
cal_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CAALFM_C111660WA (GAD1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CAALFM_C111660WA (GAD1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CAALFM_C111660WA (GAD1)
   00430 Taurine and hypotaurine metabolism
    CAALFM_C111660WA (GAD1)
Enzymes [BR:cal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CAALFM_C111660WA (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 3645339
NCBI-ProteinID: XP_713020
UniProt: A0A1D8PF79
LinkDB All DBs
Position
1
AA seq 568 aa AA seqDB search
MVLSKHIDALRLESQILKKTPQAQLRKEAFIDAYDSHKNIPQFEIPQNSSNEQLIYKYLS
QELALDGIPTLNLASFVNTYVDDTSARLIQDNLTKNLADNDEYPSLIDIQTRCISILSNL
WHAPGKVDKVTGNRVTNSIGTATTGSSEAIMLAGLALKKRWQLKRKAEGKSTDNPNILMA
TCAQVALEKFACYFDVENRLIPVTEESGHLIDVSKIKENIDENTIGIFVIMGSTFTGAFE
PVEEISKLLDEVEKERGLDIRIHVDGASGGFVAPFIFPHLKWDFAVPRVDSINTSGHKFG
LTSVGLGWVIWKDADLLPKELRFSLDYLGGVEETFGLNFSRPGFPVITQYYNFLSLGRQG
YAKIFDGCMTNARLLSRFLEESKYFDVVSVIHHKLSDSEKKAQFTREVDDKKLDSKLYTI
NEEFKPGLPVVAFRFSKEVRDKYPELPQELLSTLLRKRGYIIPNYHLPPSENDKEILRVV
VRNSLSLNLLERLIQDITGATELLIKAADSIADYVSTSGEHTDVENRERIHKLLAAIASG
GVAEVKEEKHKKDNHQGSKNKKSYRGTC
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggttttaagtaaacacattgatgctttaagattggaatcacaaattttgaaaaaaact
ccgcaagctcaattgcgtaaagaagcattcatcgatgcctatgattctcacaagaacatt
cctcaatttgaaatccctcaaaactcctcaaatgaacaattgatttataaatatctttct
caagaattggcccttgatggaatcccaactttgaatttggcatcctttgtcaacacttac
gttgatgatacatctgcaagattgattcaggacaacttgaccaaaaacttggcagacaat
gatgaatacccaagtttaattgatattcaaaccagatgtatttcaatattaagtaattta
tggcacgctcctggtaaagttgataaggtcactggtaacagagtaactaattctattggt
accgcaaccaccggttcttctgaggcaattatgttagctgggttagctttgaagaaaaga
tggcaattgaaaagaaaagctgaaggcaaatctactgacaatcccaacattttaatggcc
acatgtgctcaagtcgctttggaaaaatttgcttgctattttgatgttgaaaatagattg
attcctgtcactgaagaatcgggtcatttgattgatgtttccaagattaaggaaaatatt
gatgaaaacaccattggtatttttgttatcatgggatcaactttcactggtgcctttgaa
ccagttgaggaaatctccaaattgttggatgaagttgaaaaagaacgtggattggatatt
agaattcatgttgatggtgcatcaggtgggtttgtagctccatttattttcccacatttg
aaatgggattttgctgttcctagagttgattcaattaatacttctggtcacaagtttggg
ttgacatctgttggtttaggttgggtgatttggaaagatgctgatttgttgcctaaggaa
ttgcgtttcagtttggattatcttggtggtgttgaagaaacatttggtttgaatttttcc
agaccaggtttccctgttattacccaatattacaactttttatctttaggaagacaagga
tatgccaagatttttgatgggtgtatgaccaatgctagattgttgtcaagatttttagaa
gaaagcaagtactttgatgttgtttctgttatccaccacaaattgagtgattcggaaaag
aaagctcaattcactagagaagttgacgataaaaaattggattctaaactttatactatc
aatgaagaattcaagcctggtttgcctgttgttgccttcagattttccaaagaggttaga
gacaagtatcctgaattgccccaagaattgttgtcaacattattgagaaagaggggttac
attattccaaactatcatttgcccccatctgagaatgataaggagattttgagagttgtt
gttcgtaattcattgtcgttgaatttgttggagagattgattcaagacattactggcgct
acagaacttttgatcaaagctgctgattccattgctgattatgtttcaacaagtggtgaa
catactgatgttgaaaatagagaaagaatccacaaattattggcagctattgcttctggt
ggtgttgctgaagtgaaagaagaaaaacacaaaaaggataatcaccaaggcagcaaaaat
aaaaagtcctatcgtggtacttgttag

DBGET integrated database retrieval system