KEGG   Candida albicans: CAALFM_CR04510WAHelp
Entry
CAALFM_CR04510WA  CDS       T00189                                 

Gene name
HXK2, CaO19.542
Definition
(RefSeq) hexokinase 2
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
cal  Candida albicans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAALFM_CR04510WA (HXK2)
   00051 Fructose and mannose metabolism
    CAALFM_CR04510WA (HXK2)
   00052 Galactose metabolism
    CAALFM_CR04510WA (HXK2)
   00500 Starch and sucrose metabolism
    CAALFM_CR04510WA (HXK2)
   00520 Amino sugar and nucleotide sugar metabolism
    CAALFM_CR04510WA (HXK2)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CAALFM_CR04510WA (HXK2)
Enzymes [BR:cal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CAALFM_CR04510WA (HXK2)
Membrane trafficking [BR:cal04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CAALFM_CR04510WA (HXK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
R
AA seq 484 aa AA seqDB search
MVHLGPKPAQKRKGTFTDVSPQLLEALKPIQEQFTISADKLRAIVKHFISELDRGLSKAG
GNIPMIPGWVMDFPTGKETGSYLAIDLGGTNLRVVLVKLGGNRDFDTTQSKFALPAHMRT
ATSDELWDFIAKCLKEFVDEIYPDGCSEPLPLGFTFSYPASQNRINEGILQRWTKGWSID
GIEGKDVVPMLQKAIKKVGVPIDVVALINDTTGTLVASMYTDPEAKMGLIFGTGVNGAYF
DVVKDIPKLEGKCPSDIPPESPMAINCEYGSFDNEKYILPRTKYDVQIDEESPRPGQQTF
EKMISGYYLGEVLRLILLEFAEEKKLIFKGQNLDKLKVPYVMDASYPSKIEEDPFENLSD
VADLFREKLGIETTEPERKIIRCLAELIGERSARFSVCGIAAICQKRGYKTAHCAADGSV
YNKYPGFKERTAQALRDIYEWPADVKDPIIIVPAEDGSGVGAAVIAALTEKRLKEGKSVG
LLGA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggtgcatctcggtccaaaaccagctcaaaaaagaaagggaactttcactgatgtttct
cctcaattattagaagctcttaaaccaattcaagagcaattcaccatttctgcagacaaa
ttgagagctattgttaaacatttcatctcagaattagaccgtggtttatcaaaagctggt
ggtaacattcctatgattccaggttgggtcatggatttcccaaccggtaaagaaactggt
tcttatcttgccattgacttgggtggaaccaacttgagagttgtcttggttaaattgggc
ggtaacagagactttgacaccactcaatccaagtttgctttgccagctcacatgagaact
gccaccctggacgaattatgggattttattgctaaatgtttgaaagagtttgttgatgaa
atctacccagatggttgcagtgaaccattgccattgggtttcacatttagttatccagct
tctcaaaaccgtatcaatgaaggtatcttgcaaagatggactaaaggctggtcaattgat
ggaattgaaggaaaggatgttgttccaatgttgcaaaaagctattaagaaagttggtgtc
ccaattgatgttgttgcgttgatcaacgataccacaggtacattagttgcttctatgtac
acagacccagaagctaagatgggtttgatttttggtactggtgtcaacggtgcttatttc
gatgttgtcaaggacattcctaaattagaaggtaaatgtccatcagatattccaccagaa
tcaccaatggccatcaactgtgagtacggttcatttgataacgaaaagtatatcttgcca
agaactaaatacgatgttcaaattgacgaagaatcaccaagaccaggtcaacaaactttc
gaaaagatgatctccggttactatttgggagaagttttgagattgattttattggaattt
gctgaagagaagaaattgatcttcaaaggtcaaaaccttgacaagttgaaggttccatac
gtcatggatgcctcttatccatccaaaattgaagaagatccatttgaaaacttgtctgat
gtcgccgacttatttagagaaaaattgggcattgaaaccacagaaccagaaagaaagatt
atccgttgtttagcggaattgattggtgaaagatctgctagattctctgtttgtggtatt
gctgctatttgccaaaagagaggttacaaaaccgctcattgtgctgctgacggttcagtg
tacaacaagtacccagggttcaaagaaagaactgcccaagctttaagagacatctacgaa
tggccagctgatgtcaaggacccaatcatcattgttccagctgaagatggtagtggtgtt
ggtgctgccgttattgctgctttgaccgaaaagagattaaaagaaggtaaatccgttggt
ttgttgggtgcttag

DBGET integrated database retrieval system