KEGG   Calothrix sp. PCC 7507: Cal7507_4616Help
Entry
Cal7507_4616      CDS       T02358                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
calo  Calothrix sp. PCC 7507
Pathway
calo00010  Glycolysis / Gluconeogenesis
calo00020  Citrate cycle (TCA cycle)
calo00620  Pyruvate metabolism
calo01100  Metabolic pathways
calo01110  Biosynthesis of secondary metabolites
calo01120  Microbial metabolism in diverse environments
calo01130  Biosynthesis of antibiotics
calo01200  Carbon metabolism
Module
calo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cal7507_4616
   00020 Citrate cycle (TCA cycle)
    Cal7507_4616
   00620 Pyruvate metabolism
    Cal7507_4616
Enzymes [BR:calo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cal7507_4616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase
Motif
Other DBs
NCBI-ProteinID: AFY34982
UniProt: K9PQZ7
LinkDB All DBs
Position
complement(5237724..5239010)
Genome map
AA seq 428 aa AA seqDB search
MSIHEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVESFYEGYLAHI
LVPAGESTTVGSAIAYIAETEAEIATAKSLANSGGASTPATPTPQPVAVTASVGTPTLAS
QNGSNHREGRVVVSPRARKLAKELKVDLNTLKGSGPYGRIVAEDVEAAANQGKQPAAKPL
TPQPSTPTIIPTAPAPTPVTSSAIPGQIVPLTTFQNAVVRNMVATISVPVFRVGYTITTD
GLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLINASYSDQGIVYHSDINISVAVAMDDG
GLITPVLKNADIVDIYSLSRTWKSLVERARSKQLQPDEYNSGTFTLSNLGMFGVDTFDAI
LPPGQGSILAIGASTPQVVATGDGLFGVRQQMQVNITADHRIIYGAHAAAFLRDLTKLIE
TNPQSLTL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagcattcacgaagtatttatgccggcgctgagttccacgatgactgaaggcaaaatc
gtctcctgggtgaaatcgccaggcgataaagtggagaaaggcgaaacagtggtggttgtc
gagtcagataaggcagatatggatgtggaatccttttatgaaggatatcttgcccatatt
ttagtgccagctggtgaaagtacaaccgtgggatctgcgatcgcctatatcgccgaaacg
gaagctgaaattgcaactgctaagtctctagccaattccggtggtgcgtctacccctgct
actcctactcctcaaccagtcgccgtcaccgcctcagtggggacacctaccttagcttct
caaaatggttctaaccaccgtgaaggtagggttgtggtttcaccccgtgcccgtaagtta
gcaaaagaactaaaagttgatttaaatacacttaaaggcagtggcccctacgggcgcatc
gtcgctgaggatgtggaagcagcagcaaatcagggtaagcaaccagccgctaaaccactt
acaccacagccatcgacaccgacaatcatccccacagcacctgcacctactccagtgacc
agcagcgctatacctggtcaaatagtgcccctcactaccttccaaaatgccgtagtgcgg
aatatggtagctaccatctccgttccagtcttccgtgtgggttacacaatcacaactgac
ggcttagacaagctctacaagcagattaagtccaaaggggtgacaatgacagccctacta
gcaaaagctgtagcggtgacattacaaaaacacccattaataaatgctagctattctgac
caaggaattgtttatcattctgacatcaacatttctgtagctgtagctatggatgatggc
ggattgattacacctgtattaaagaacgcagatatagtagacatttattctctatcgcgc
acttggaagtctttagtagaacgcgctagaagcaagcaactacaaccagacgaatataac
agtggcactttcaccctatctaacttgggaatgtttggtgtagacacatttgacgcaatt
ttgccacctggacaaggttcgattttagcgatcggggcgtctactccgcaagtagtagcc
acaggcgatggtttatttggtgtacgccaacaaatgcaagtaaatattactgccgatcac
cgaattatctatggtgcccatgcagccgcattcttgcgagatttgacgaagttgattgag
acaaatcctcaatccttgacactctaa

DBGET integrated database retrieval system